SNCA

čvor stranica na Wikimediji

Alfa-sinuklein jest protein koji je kod ljudi kodiran genom SNCA sa hromosoma 21.[1] Alfa-sinuklein je neuronski protein koji reguliše sinapsni vezikulski promet i naknadno oslobađanje neurotransmitera.

SNCA
Identifikatori
Aliasi
Vanjski ID-jeviGeneCards: [1]
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

n/a

n/a

RefSeq (bjelančevina)

n/a

n/a

Lokacija (UCSC)n/an/a
PubMed pretragan/an/a
Wikipodaci
Pogledaj/uredi – čovjek

Ima ga u izobilju u mozgu, dok se manje količine nalaze u srcu, mišićima i drugim tkivima. U mozgu, alfa-sinuklein nalazi se uglavnom u aksonskim terminalima presinapsnih neurona.[1] Unutar ovih terminala, alfa-sinuklein stupa u interakciju sa fosfolipididima.[2] and proteins.[1][3][4] Presinapsnii terminali oslobađaju hemijske glasnike, zvane neurotransmiteri, iz odjeljaka poznatih kao sinapsne vezikule. Oslobađanje neurotransmitera prenosi signale između neurona i ključno je za normalnu funkciju mozga.[1]

Ljudski alfa-sinuklein protein sastoji se od 140 aminokiselina.[5][6][7] Fragment alfa-sinukleina, poznat kao ne-Abeta komponenta (NAC) amiloida Alzhemerove bolesti, prvobitno pronađen u frakciji obogaćenoj amiloidom, pokazao se kao fragment njegovog prekursorskog proteina, NACP.[5] Kasnije je utvrđeno da je NACP ljudski homolog sinukleina u rodu Torpedo. Stoga se NACP sada naziva ljudski alfa-sinuklein.[8]

Tkivna ekspresijaUredi

Alfa-sinuklein je sinukleinski protein nepoznate funkcije koji se prvenstveno nalazi u nervnom tkivu, čineći čak jedan posto svih proteina u citosolu moždanih ćelija.[9] To je pretežno neuronski protein eksprimiran u neokorteksu, hipokampusu, substantia nigra, talamusu i cerebellumu, ali se može naći i u neneuronskim ćrlijama glije.[10] Kod melanocita ekspresija SNCA proteina može biti regulirana transkripcijskim faktorom povezanim s mikroftalmijom (MITF).[11]

Utvrđeno je da je alfa-sinuklein u velikoj mjeri lokaliziran u jedru moždanih ]neurona sisara, što ukazuje na ulogu alfa-sinukleina u jedru.[12] Međutim, sinuklein se uglavnom nalazi na presinapsnim krajevima, u slobodnom ili membranom vezanom obliku,[13] pri čemu je otprilike 15% sinukleina vezano za membranu u bilo kojem periodu u neuronima.[14]

Takođe je pokazano da je alfa-sinuklein lokalizovan u neuronskim mitohondrijama.[15][16] Alfa-sinuklein je visoko eksprimiran u mitohondrijama olfaktornih režnjeva, hipokampusu, strijatumu i talamusu, gdje je citosolni alfa-sinuklein također bogat. Međutim, moždana kora i mali mozak su dva izuzetka, koji sadrže bogat citosolni alfa-sinuklein, ali vrlo niske nivoe mitohondrijskog alfa-sinukleina. Pokazalo se da se alfa-sinuklein nalazi u unutrašnjoj membrani mitohondrija, te da je inhibitorni efekat alfa-sinukleina na kompleks I, aktivnosti mitohondrijskog respiratornog lanca ovbisne od doze. Stoga se sugerira da je alfa-sinuklein u mitohondrijama različito eksprimiran u različitim regijama mozga, a pozadinski nivoi mitohondrijskog alfa-sinukleina mogu biti potencijalni faktor koji utiče na funkciju mitohondrija i predisponira neke neurone na degeneraciju.[16]

Najmanje tri izoforme sinukleina proizvode se alternativnom preradom.[17] Najveći oblik proteina, i onaj koji se najviše istražuje, je protein pune dužine od 140 aminokiselina. Druge izoforme su alfa-sinuklein-126, kojem nedostaju ostaci 41-54 zbog gubitka egzona 3 i alfa-sinuklein-112,[18] kojem nedostaju ostataci 103 –130 zbog gubitka egzona 5.[17]

Aminokiselinska sekvencaUredi

Dužina polipeptidnog lanca je 140 aminokiselina, a molekulska težina 14.460 Da.

1020304050
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH
GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL
GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

StrukturaUredi

Alfa-sinuklein u rastvoru smatra se unutrašnje poremećenim proteinom, tj. nedostaje mu jedna stabilna 3D struktura.[19][20] Od 2014. godine, sve veći broj izvještaja sugerira, međutim, prisustvo parcijalnih struktura ili uglavnom strukturiranih oligomernih stanja u strukturi rastvora alfa-sinukleina čak i u odsustvu lipida. Ovaj trend je također podržan velikim brojem mjerenja pojedinačnih molekula (optičkom pincetom) na pojedinačnim kopijama monomernog alfa-sinukleina, kao i kovalentno pojačanih dimera ili tetramera alfa-sinukleina.[21]

Alfa-sinuklein je specifično je naviše regulirana u diskretnoj populaciji presinapsnih terminala mozga tokom perioda sinapsnog preuređivanja vezanog za akviziciju.[22] It has been shown that alpha-synuclein significantly interacts with tubulin,[23] i da alfa-sinuklein može imati aktivnost kao potencijalni protein povezan sa mikrotubulama, kao što je tau.[24] Dokazi sugeriraju da alfa-sinuklein funkcionira kao molekulski prattelj u formiranju kompleksa SNARE.[25][26] Konkretno, istovremeno se vezuje za fosfolipide plazmamembrana preko svog N-terminalnog domena i za sinaptobrevin-2, preko svog C-terminalnog domena, sa povećanim značajem tokom sinapsne aktivnosti.[27] Ustvari, sve je više dokaza da je alfa-sinuklein uključen u funkcionisanje neuronskog Golgijevog aparata i prometu vezikula.[28]

Pokazalo se da alfa-sinuklein značajno interraguje sa tubulinom,[23] i da alfa-sinuklein može imati aktivnost kao potencijalni protein povezan sa mikrotubulama, kao tau.[24]

Navodno je alfa-sinuklein neophodan za normalan razvoj kognitivnih funkcija. Nokaut-miševi s ciljanom inaktivacijom ekspresije alfa-sinukleina pokazuju narušeno prostorno učenje i radno pamćenje.[29]

FunkcijaUredi

Iako funkcija alfa-sinukleina nije dobro shvaćena, studije sugeriraju da on ima ulogu u ograničavanju mobilnosti sinapsnih vezikula, posljedično prigušujući recikliranje sinapsnih vezikula i oslobađanje neurotransmitera.[30][31][32][33][34][35][3]

Alternativno mišljenje je da se alfa-sinuklein vezuje za VAMP2 (sinaptobrevin) i stabilizuje SNARE komplekse;[27][36][37][38][39] iako nedavne studije pokazuju da je vezivanje alfa-sinukleina-VAMP2 ključno za alfa-sinuklein-posredovanu atenuaciju reciklaže sinapsnih vezikula, povezujući dva naizgled divergentna pogleda.[3] Također može pomoći u reguliranju oslobađanja dopamina, tipa neurotransmitera koji je kritičan za kontrolu početka i zaustavljanja voljnih i nevoljnih pokreta.[1]

Alfa-sinuklein modulira procese popravama DNK , uključujući popravku dvolančanih prekida (DSB).[40] Markeri odgovora na oštećenje DNK kolokalizuju se sa alfa-sinukleinom da formiraju diskretna žarišta u ljudskim ćelijama i mišjeg mozga. Smanjenje alfa-sinukleina u ljudskim ćelijama uzrokuje povećano uvođenje DNK DSB-a, nakon izlaganja bleomicinu i smanjenu sposobnost popravljanja ovih DSB-a. Osim toga, alfa-sinuklein nokaut-miševa pokazuje viši nivo DSB-a, a ovaj problem se može ublažiti transgenim ponovnim uvođenjem ljudskog alfa-sinukleina. Alfa-sinuklein promovira put popravke DSB-a koji se naziva nehomologno spajanje krajeva.[40] Čini se da je funkcija popravke DNK alfa-sinukleina ugrožena u Lewijevom tijelu neurona koji nose inkluziju , a to može izazvati ćelijsku smrt.

SekvencaUredi

Alfa-sinukleinska primarna struktura dijeli se obično u tri različita domena:

Klinički značajUredi

 
Pozitivno α-sinukleinsko bojenje Lewyjevog tijela pacijenta koji je imao Parkinsonovu bolest.

Klasično smatran nestrukturitani protein rastvorljivi, nemutirani α-sinuklein formira stabilno savijeni tetramer koji se opire agregaciji.[45] Ovo zapažanje, iako je reprodukovano i prošireno u nekoliko laboratorija,[46][47][48] još uvijek je predmet debate na terenu zbog oprečnih izvještaja.[49][50][51] Ipak, alfa-sinuklein se agregira i formira nerastvorljiva vlakna u patološkim stanjima koja karakteriziraju Lewyjeva tijela, kao što su Parkinsonova bolest, demencija s Lewyjevim telima i atrofija višestrukih sistema.[52][53] Ovi poremećaji su poznati kao sinukleinopatije. In vitro modeli sinukleinopatija otkrili su da agregacija alfa-sinukleina može dovesti do različitih ćelijskih poremećaja, uključujući oštećenje mikrotubula, sinapsne i mitohondrijske disfunkcije, oksidativni stres, kao i disregulaciju signalizacije kalcija, proteasomskog i lizosomskog puta.[54] Alfa-sinuklein je strukturna komponenta fibrila Lewyjevog tijela. Povremeno, Lewyjeva tijela sadrže tau protein;[55] međutim, alfa-sinuklein i tau čine dva karakteristična podskupa filamenata u istim inkluzivnim tijelima.[56] Patologija alfa-sinukleina se također javlja u sporadičnim i porodičnim slučajevima s Alzheimerovom bolešću.[57]

Mehanizam agregacije alfa-sinukleina je neizvjestan. Postoje dokazi o strukturiranom međuproduktu bogatom beta strukturom koji može biti prethodnik agregacije i, konačno, Lewyjevih tijela.[58] Studija o jednj molekuli iz 2008. sugerira da alfa-sinuklein postoji kao mješavina nestrukturiranih, alfa-heliksa i beta-listova bogatih konformerama u ravnoteži. Mutacije ili uvjeti pufera za koje se zna da poboljšavaju agregaciju snažno povećavaju skupinu beta konformera, što sugerira da bi ovo mogla biti konformacija povezana s patogenom agregacijom.[59] Jedna teorija je da se većina agregata alfa-sinukleina nalazi u presinapsi kao manje naslage što uzrokuje disfunkciju sinapsi.[60] Među strategijama za liječenje sinukleinopatija su spojevi koji inhibiraju agregaciju alfa-sinukleina. Pokazalo se da mala molekula kuminaldehida inhibira fibrilaciju alfa-sinukleina.[61] Za ove poremećaje, također je podrazumijevajući i Epstein-Barrov virus.[62]

U rijetkim slučajevima porodičnih oblika Parkinsonove bolesti, postoji genska mutacija kodiranja alfa-sinukleina. Do sada je identifikovano pet tačkastih mutacija: A53T,[63] A30P,[64] E46K,[65] H50Q[66] i G51D; [67] međutim, u genu SNCA, s parkinsonizmom povezano je ukupno 19 mutacija: A18T, A29S, A53E, A53V, E57A, V15A, T72M, L8I, V15D, M127I, P117S, M5T, G93A, A E83G. [68]

Prijavljeno je da neke mutacije utiču na inicijaciju i korake amplifikacije procesa agregacije.[69][70] Genomske duplikacije i umnožavanje gena izgledaju kao rijedak uzrok Parkinsonove bolesti u drugim lozama, iako je češći od tačkastih mutacija.[71][72] Stoga određene mutacije alfa-sinukleina mogu uzrokovati stvaranje fibrila sličnih amiloidima koji doprinose Parkinsonovoj bolesti. Prekomjerna ekspresija alfa-sinukleina divljeg tipa ili A53T-mutantnog alfa-sinukleina kod primata dovodi do taloženja alfa-sinukleina u ventralnom dijelu srednjeg mozga, degeneracije dopaminskog sistema i narušenih motorinih performansi.[73]

Određeni dijelovi proteina alfa-sinukleina mogu imati ulogu u tauopatijama.[74][75][76]

Prion skioblik proteina alfa-sinukleina može biti uzročnik bolesti atrofija više sistema.[77][78][79]

 
Događaji u toksičnosti α-sinukleina.[80]

Opisani su samoreplicirajući amiloidni sklopovi alfa-sinukleina koji su nevidljivi za amiloidnu boju tioflavin-T i koji se mogu akutno širiti u neuronima i in vitro i in vivo.[81]

Antitijela protiv alfa-sinukleina zamenila su antitijela protiv ubikvitina, kao zlatnog standarda za imunobojenje Lewyjevih tela.[82] Centralni panel na slici desno pokazuje glavni put za agregaciju proteina. Monomerni α-sinuklein se prirodno odvija u rastvoru, ali se također može vezati za membrane u α-heliksnom obliku. Čini se vjerojatnim da ova dva tipa postoje u ravnoteži unutar ćelije, iako to nije dokazano. Iz rada in vitro, jasno je da se nesavijeni monomer može prvo agregirati u male oligomerne tipove koji se mogu stabilizirati interakcijama sličnim β-listu, a zatim u nerastvorljive fibrile veće molekulske težine. U ćelijskom kontekstu, postoje neki dokazi da prisustvo lipida može podstaknuti stvaranje oligomera: α-sinuklein također može formirati prstenaste strukture nalik porama koje su u interakciji s membranama. Taloženje α-sinukleina u patološke strukture kao što su Lewyjeva tijela vjerovatno je kasni događaj koji se javlja u nekim neuronima. Na lijevoj strani su neki od poznatih modifikatora ovog procesa. Električna aktivnost u neuronima mijenja povezanost α-sinukleina sa vezikulama i može također stimulirati polo-like kinaze 2 (PLK2), za koje se pokazalo da fosforiliraju α-sinuklein na Ser129. Predloženo je da budu uključene i druge kinaze. Kao i fosforilacija, skraćivanje putem proteaza kao što su kalpaini i nitracija, vjerovatno putem dušik-oksida (NO) ili drugih reaktivnih azotnih vrsta koje su prisutne tokom upale, što modificira sinuklein tako da ima veću sklonost agregaciji . Dodavanje ubikvitina (prikazano kao crna tačka) Lewyjevim tijelima je vjerovatno sekundarni proces taloženja. Na desnoj strani su neki od predloženih ćelijskih ciljeva za toksičnost posredovanu α-sinukleinom, koji uključuju (od vrha do dna) ER-Golgijev transport, sinapsne vezikule, mitohondrije i lizosome i druge proteolitske mhanizme. U svakom od ovih slučajeva, predlaže se da α-sinuklein ima štetne efekte, koji su navedeni ispod svake strelice, iako još nije jasno da li je bilo šta od njih neophodno ili dovoljno za toksičnost u neuronima.

Interakcije protein-proteinUredi

Pokazalo se da alfa-sinuklein reaguje sa

Također pogledajteUredi

ReferenceUredi

  1. ^ a b c d e "Genetics Home Reference: SNCA". U.S. National Library of Medicine. 12 Nov 2013. Pristupljeno 14 Nov 2013.
  2. ^ Chandra S, Chen X, Rizo J, Jahn R, Südhof TC (April 2003). "A broken alpha -helix in folded alpha -Synuclein". The Journal of Biological Chemistry. 278 (17): 15313–8. doi:10.1074/jbc.M213128200. PMID 12586824. S2CID 27116894.
  3. ^ a b c Sun J, Wang L, Bao H, Premi S, Das U, Chapman ER, Roy S (June 2019). "Functional cooperation of α-synuclein and VAMP2 in synaptic vesicle recycling". Proceedings of the National Academy of Sciences of the United States of America. 116 (23): 11113–11115. doi:10.1073/pnas.1903049116. PMC 6561242. PMID 31110017.
  4. ^ Atias M, Tevet Y, Sun J, Stavsky A, Tal S, Kahn J, et al. (June 2019). "Synapsins regulate α-synuclein functions". Proceedings of the National Academy of Sciences of the United States of America. 116 (23): 11116–11118. doi:10.1073/pnas.1903054116. PMC 6561288. PMID 31110014.
  5. ^ a b c Uéda K, Fukushima H, Masliah E, Xia Y, Iwai A, Yoshimoto M, et al. (December 1993). "Molecular cloning of cDNA encoding an unrecognized component of amyloid in Alzheimer disease". Proceedings of the National Academy of Sciences of the United States of America. 90 (23): 11282–6. Bibcode:1993PNAS...9011282U. doi:10.1073/pnas.90.23.11282. PMC 47966. PMID 8248242.
  6. ^ Xia Y, Saitoh T, Uéda K, Tanaka S, Chen X, Hashimoto M, et al. (October 2001). "Characterization of the human alpha-synuclein gene: Genomic structure, transcription start site, promoter region and polymorphisms". Journal of Alzheimer's Disease. 3 (5): 485–494. doi:10.3233/JAD-2001-3508. PMID 12214035. Arhivirano s originala, 2016-05-14. Pristupljeno 2009-02-19.
  7. ^ Xia Y, Saitoh T, Uéda K, Tanaka S, Chen X, Hashimoto M, Hsu L, Conrad C, Sundsmo M, Yoshimoto M, Thal L, Katzman R, Masliah E (2002). "Characterization of the human alpha-synuclein gene: Genomic structure, transcription start site, promoter region and polymorphisms: Erratum p489 Fig 3". J. Alzheimers Dis. 4 (4): 337. Arhivirano s originala, 2016-05-14. Pristupljeno 2009-02-19.
  8. ^ Jakes, Ross; Spillantini, Maria Grazia; Goedert, Michel (1994). "Identification of two distinct synucleins from human brain". FEBS Letters. 345 (1): 27–32. doi:10.1016/0014-5793(94)00395-5. PMID 8194594. S2CID 36840279.
  9. ^ Iwai A, Masliah E, Yoshimoto M, Ge N, Flanagan L, de Silva HA, et al. (February 1995). "The precursor protein of non-A beta component of Alzheimer's disease amyloid is a presynaptic protein of the central nervous system". Neuron. 14 (2): 467–75. doi:10.1016/0896-6273(95)90302-X. PMID 7857654. S2CID 17941420.
  10. ^ Filippini A, Gennarelli M, Russo I (March 2019). "α-Synuclein and Glia in Parkinson's Disease: A Beneficial or a Detrimental Duet for the Endo-Lysosomal System?". Cellular and Molecular Neurobiology. 39 (2): 161–168. doi:10.1007/s10571-019-00649-9. PMID 30637614. S2CID 58006790.
  11. ^ Hoek KS, Schlegel NC, Eichhoff OM, Widmer DS, Praetorius C, Einarsson SO, et al. (December 2008). "Novel MITF targets identified using a two-step DNA microarray strategy". Pigment Cell & Melanoma Research. 21 (6): 665–76. doi:10.1111/j.1755-148X.2008.00505.x. PMID 19067971. S2CID 24698373.
  12. ^ Yu S, Li X, Liu G, Han J, Zhang C, Li Y, et al. (March 2007). "Extensive nuclear localization of alpha-synuclein in normal rat brain neurons revealed by a novel monoclonal antibody". Neuroscience. 145 (2): 539–55. doi:10.1016/j.neuroscience.2006.12.028. PMID 17275196. S2CID 37294944.
  13. ^ McLean PJ, Kawamata H, Ribich S, Hyman BT (March 2000). "Membrane association and protein conformation of alpha-synuclein in intact neurons. Effect of Parkinson's disease-linked mutations". The Journal of Biological Chemistry. 275 (12): 8812–6. doi:10.1074/jbc.275.12.8812. PMID 10722726.
  14. ^ Lee HJ, Choi C, Lee SJ (January 2002). "Membrane-bound alpha-synuclein has a high aggregation propensity and the ability to seed the aggregation of the cytosolic form". The Journal of Biological Chemistry. 277 (1): 671–8. doi:10.1074/jbc.M107045200. PMID 11679584. S2CID 10438997.
  15. ^ Zhang L, Zhang C, Zhu Y, Cai Q, Chan P, Uéda K, et al. (December 2008). "Semi-quantitative analysis of alpha-synuclein in subcellular pools of rat brain neurons: an immunogold electron microscopic study using a C-terminal specific monoclonal antibody". Brain Research. 1244: 40–52. doi:10.1016/j.brainres.2008.08.067. PMID 18817762. S2CID 1737088.
  16. ^ a b Liu G, Zhang C, Yin J, Li X, Cheng F, Li Y, et al. (May 2009). "alpha-Synuclein is differentially expressed in mitochondria from different rat brain regions and dose-dependently down-regulates complex I activity". Neuroscience Letters. 454 (3): 187–92. doi:10.1016/j.neulet.2009.02.056. PMID 19429081. S2CID 45120745.
  17. ^ a b Beyer K (September 2006). "Alpha-synuclein structure, posttranslational modification and alternative splicing as aggregation enhancers". Acta Neuropathologica. 112 (3): 237–51. doi:10.1007/s00401-006-0104-6. PMID 16845533. S2CID 1367846.
  18. ^ Uéda K, Saitoh T, Mori H (December 1994). "Tissue-dependent alternative splicing of mRNA for NACP, the precursor of non-A beta component of Alzheimer's disease amyloid". Biochemical and Biophysical Research Communications. 205 (2): 1366–72. doi:10.1006/bbrc.1994.2816. PMID 7802671.
  19. ^ van Rooijen BD, van Leijenhorst-Groener KA, Claessens MM, Subramaniam V (December 2009). "Tryptophan fluorescence reveals structural features of alpha-synuclein oligomers". Journal of Molecular Biology. 394 (5): 826–33. doi:10.1016/j.jmb.2009.10.021. PMID 19837084.
  20. ^ Weinreb PH, Zhen W, Poon AW, Conway KA, Lansbury PT (October 1996). "NACP, a protein implicated in Alzheimer's disease and learning, is natively unfolded". Biochemistry. 35 (43): 13709–15. doi:10.1021/bi961799n. PMID 8901511.
  21. ^ Neupane K, Solanki A, Sosova I, Belov M, Woodside MT (January 2014). "Diverse metastable structures formed by small oligomers of α-synuclein probed by force spectroscopy". PLOS ONE. 9 (1): e86495. Bibcode:2014PLoSO...986495N. doi:10.1371/journal.pone.0086495. PMC 3901707. PMID 24475132.
  22. ^ George JM, Jin H, Woods WS, Clayton DF (August 1995). "Characterization of a novel protein regulated during the critical period for song learning in the zebra finch". Neuron. 15 (2): 361–72. doi:10.1016/0896-6273(95)90040-3. PMID 7646890. S2CID 11421888.
  23. ^ a b Alim MA, Hossain MS, Arima K, Takeda K, Izumiyama Y, Nakamura M, et al. (January 2002). "Tubulin seeds alpha-synuclein fibril formation". The Journal of Biological Chemistry. 277 (3): 2112–7. doi:10.1074/jbc.M102981200. PMID 11698390. S2CID 84374030.
  24. ^ a b Alim MA, Ma QL, Takeda K, Aizawa T, Matsubara M, Nakamura M, et al. (August 2004). "Demonstration of a role for alpha-synuclein as a functional microtubule-associated protein". Journal of Alzheimer's Disease. 6 (4): 435–42, discussion 443–9. doi:10.3233/JAD-2004-6412. PMID 15345814.
  25. ^ Bonini NM, Giasson BI (November 2005). "Snaring the function of alpha-synuclein". Cell. 123 (3): 359–61. doi:10.1016/j.cell.2005.10.017. PMID 16269324. S2CID 18772904.
  26. ^ Chandra S, Gallardo G, Fernández-Chacón R, Schlüter OM, Südhof TC (November 2005). "Alpha-synuclein cooperates with CSPalpha in preventing neurodegeneration". Cell. 123 (3): 383–96. doi:10.1016/j.cell.2005.09.028. PMID 16269331. S2CID 18173864.
  27. ^ a b c Burré J, Sharma M, Tsetsenis T, Buchman V, Etherton MR, Südhof TC (September 2010). "Alpha-synuclein promotes SNARE-complex assembly in vivo and in vitro". Science. 329 (5999): 1663–7. Bibcode:2010Sci...329.1663B. doi:10.1126/science.1195227. PMC 3235365. PMID 20798282.
  28. ^ Cooper AA, Gitler AD, Cashikar A, Haynes CM, Hill KJ, Bhullar B, et al. (July 2006). "Alpha-synuclein blocks ER-Golgi traffic and Rab1 rescues neuron loss in Parkinson's models". Science. 313 (5785): 324–8. Bibcode:2006Sci...313..324C. doi:10.1126/science.1129462. PMC 1983366. PMID 16794039.
  29. ^ Kokhan VS, Afanasyeva MA, Van'kin GI (May 2012). "α-Synuclein knockout mice have cognitive impairments". Behavioural Brain Research. 231 (1): 226–30. doi:10.1016/j.bbr.2012.03.026. PMID 22469626. S2CID 205884600.
  30. ^ Larsen KE, Schmitz Y, Troyer MD, Mosharov E, Dietrich P, Quazi AZ, et al. (November 2006). "Alpha-synuclein overexpression in PC12 and chromaffin cells impairs catecholamine release by interfering with a late step in exocytosis". The Journal of Neuroscience. 26 (46): 11915–22. doi:10.1523/JNEUROSCI.3821-06.2006. PMC 6674868. PMID 17108165.
  31. ^ Nemani VM, Lu W, Berge V, Nakamura K, Onoa B, Lee MK, et al. (January 2010). "Increased expression of alpha-synuclein reduces neurotransmitter release by inhibiting synaptic vesicle reclustering after endocytosis". Neuron. 65 (1): 66–79. doi:10.1016/j.neuron.2009.12.023. PMC 3119527. PMID 20152114.
  32. ^ Scott DA, Tabarean I, Tang Y, Cartier A, Masliah E, Roy S (June 2010). "A pathologic cascade leading to synaptic dysfunction in alpha-synuclein-induced neurodegeneration". The Journal of Neuroscience. 30 (24): 8083–95. doi:10.1523/JNEUROSCI.1091-10.2010. PMC 2901533. PMID 20554859.
  33. ^ Scott D, Roy S (July 2012). "α-Synuclein inhibits intersynaptic vesicle mobility and maintains recycling-pool homeostasis". The Journal of Neuroscience. 32 (30): 10129–35. doi:10.1523/JNEUROSCI.0535-12.2012. PMC 3426499. PMID 22836248.
  34. ^ Vargas KJ, Makani S, Davis T, Westphal CH, Castillo PE, Chandra SS (July 2014). "Synucleins regulate the kinetics of synaptic vesicle endocytosis". The Journal of Neuroscience. 34 (28): 9364–76. doi:10.1523/JNEUROSCI.4787-13.2014. PMC 4087213. PMID 25009269.
  35. ^ Wang L, Das U, Scott DA, Tang Y, McLean PJ, Roy S (October 2014). "α-synuclein multimers cluster synaptic vesicles and attenuate recycling". Current Biology. 24 (19): 2319–26. doi:10.1016/j.cub.2014.08.027. PMC 4190006. PMID 25264250.
  36. ^ Burré J, Sharma M, Südhof TC (March 2018). "Cell Biology and Pathophysiology of α-Synuclein". Cold Spring Harbor Perspectives in Medicine. 8 (3): a024091. doi:10.1101/cshperspect.a024091. PMC 5519445. PMID 28108534.
  37. ^ Burré J, Sharma M, Südhof TC (October 2012). "Systematic mutagenesis of α-synuclein reveals distinct sequence requirements for physiological and pathological activities". The Journal of Neuroscience. 32 (43): 15227–42. doi:10.1523/JNEUROSCI.3545-12.2012. PMC 3506191. PMID 23100443.
  38. ^ Burré J, Sharma M, Südhof TC (October 2014). "α-Synuclein assembles into higher-order multimers upon membrane binding to promote SNARE complex formation". Proceedings of the National Academy of Sciences of the United States of America. 111 (40): E4274-83. Bibcode:2014PNAS..111E4274B. doi:10.1073/pnas.1416598111. PMC 4210039. PMID 25246573.
  39. ^ Diao J, Burré J, Vivona S, Cipriano DJ, Sharma M, Kyoung M, et al. (April 2013). "Native α-synuclein induces clustering of synaptic-vesicle mimics via binding to phospholipids and synaptobrevin-2/VAMP2". eLife. 2: e00592. doi:10.7554/eLife.00592. PMC 3639508. PMID 23638301.
  40. ^ a b Schaser AJ, Osterberg VR, Dent SE, Stackhouse TL, Wakeham CM, Boutros SW, Weston LJ, Owen N, Weissman TA, Luna E, Raber J, Luk KC, McCullough AK, Woltjer RL, Unni VK (Jul 2019). "Alpha-synuclein is a DNA binding protein that modulates DNA repair with implications for Lewy body disorders". Sci Rep. 9 (1): 10919. Bibcode:2019NatSR...910919S. doi:10.1038/s41598-019-47227-z. PMC 6662836. PMID 31358782.
  41. ^ Clayton DF, George JM (1998). "The synucleins: a family of proteins involved in synaptic function, plasticity, neurodegeneration and disease". Trends in Neurosciences. 21 (6): 249–254. doi:10.1016/S0166-2236(97)01213-7. PMID 9641537. S2CID 20654921.
  42. ^ Bussell R, Eliezer D (June 2003). "A structural and functional role for 11-mer repeats in alpha-synuclein and other exchangeable lipid binding proteins". Journal of Molecular Biology. 329 (4): 763–78. doi:10.1016/S0022-2836(03)00520-5. PMID 12787676.
  43. ^ Uchihara T, Giasson BI (January 2016). "Propagation of alpha-synuclein pathology: hypotheses, discoveries, and yet unresolved questions from experimental and human brain studies". Acta Neuropathologica. 131 (1): 49–73. doi:10.1007/s00401-015-1485-1. PMC 4698305. PMID 26446103.
  44. ^ Sorrentino ZA, Xia Y, Gorion KM, Hass E, Giasson BI (April 2020). "Carboxy-terminal truncations of mouse α-synuclein alter aggregation and prion-like seeding". FEBS Letters. 594 (8): 1271–1283. doi:10.1002/1873-3468.13728. PMC 7188589. PMID 31912891.
  45. ^ Bartels T, Choi JG, Selkoe DJ (August 2011). "α-Synuclein occurs physiologically as a helically folded tetramer that resists aggregation". Nature. 477 (7362): 107–10. Bibcode:2011Natur.477..107B. doi:10.1038/nature10324. PMC 3166366. PMID 21841800.
  46. ^ Dettmer U, Newman AJ, Luth ES, Bartels T, Selkoe D (March 2013). "In vivo cross-linking reveals principally oligomeric forms of α-synuclein and β-synuclein in neurons and non-neural cells". The Journal of Biological Chemistry. 288 (9): 6371–85. doi:10.1074/jbc.M112.403311. PMC 3585072. PMID 23319586.
  47. ^ Westphal CH, Chandra SS (January 2013). "Monomeric synucleins generate membrane curvature". The Journal of Biological Chemistry. 288 (3): 1829–40. doi:10.1074/jbc.M112.418871. PMC 3548493. PMID 23184946.
  48. ^ Trexler AJ, Rhoades E (May 2012). "N-Terminal acetylation is critical for forming α-helical oligomer of α-synuclein". Protein Science. 21 (5): 601–5. doi:10.1002/pro.2056. PMC 3403458. PMID 22407793.
  49. ^ Fauvet B, Mbefo MK, Fares MB, Desobry C, Michael S, Ardah MT, et al. (May 2012). "α-Synuclein in central nervous system and from erythrocytes, mammalian cells, and Escherichia coli exists predominantly as disordered monomer". The Journal of Biological Chemistry. 287 (19): 15345–64. doi:10.1074/jbc.M111.318949. PMC 3346117. PMID 22315227.
  50. ^ Burré J, Vivona S, Diao J, Sharma M, Brunger AT, Südhof TC (June 2013). "Properties of native brain α-synuclein". Nature. 498 (7453): E4–6, discussion E6–7. Bibcode:2013Natur.498E...4B. doi:10.1038/nature12125. PMC 4255827. PMID 23765500.
  51. ^ Theillet FX, Binolfi A, Bekei B, Martorana A, Rose HM, Stuiver M, et al. (February 2016). "Structural disorder of monomeric α-synuclein persists in mammalian cells". Nature. 530 (7588): 45–50. Bibcode:2016Natur.530...45T. doi:10.1038/nature16531. hdl:11336/53199. PMID 26808899. S2CID 4461465.
  52. ^ Spillantini MG, Schmidt ML, Lee VM, Trojanowski JQ, Jakes R, Goedert M (August 1997). "Alpha-synuclein in Lewy bodies". Nature. 388 (6645): 839–40. Bibcode:1997Natur.388..839G. doi:10.1038/42166. PMID 9278044. S2CID 4419837.
  53. ^ Mezey E, Dehejia A, Harta G, Papp MI, Polymeropoulos MH, Brownstein MJ (July 1998). "Alpha synuclein in neurodegenerative disorders: murderer or accomplice?". Nature Medicine. 4 (7): 755–7. doi:10.1038/nm0798-755. PMID 9662355. S2CID 46196799.
  54. ^ Marvian AT, Koss DJ, Aliakbari F, Morshedi D, Outeiro TF (September 2019). "In vitro models of synucleinopathies: informing on molecular mechanisms and protective strategies". Journal of Neurochemistry. 150 (5): 535–565. doi:10.1111/jnc.14707. PMID 31004503. S2CID 125080534.
  55. ^ Arima K, Hirai S, Sunohara N, Aoto K, Izumiyama Y, Uéda K, et al. (October 1999). "Cellular co-localization of phosphorylated tau- and NACP/alpha-synuclein-epitopes in lewy bodies in sporadic Parkinson's disease and in dementia with Lewy bodies". Brain Research. 843 (1–2): 53–61. doi:10.1016/S0006-8993(99)01848-X. PMID 10528110. S2CID 11144367.
  56. ^ Arima K, Mizutani T, Alim MA, Tonozuka-Uehara H, Izumiyama Y, Hirai S, Uéda K (August 2000). "NACP/alpha-synuclein and tau constitute two distinctive subsets of filaments in the same neuronal inclusions in brains from a family of parkinsonism and dementia with Lewy bodies: double-immunolabeling fluorescence and electron microscopic studies". Acta Neuropathologica. 100 (2): 115–21. doi:10.1007/s004010050002. PMID 10963357. S2CID 22950302.
  57. ^ Yokota O, Terada S, Ishizu H, Ujike H, Ishihara T, Nakashima H, et al. (December 2002). "NACP/alpha-synuclein, NAC, and beta-amyloid pathology of familial Alzheimer's disease with the E184D presenilin-1 mutation: a clinicopathological study of two autopsy cases". Acta Neuropathologica. 104 (6): 637–48. doi:10.1007/s00401-002-0596-7. PMID 12410385. S2CID 42542929.
  58. ^ Kim HY, Heise H, Fernandez CO, Baldus M, Zweckstetter M (September 2007). "Correlation of amyloid fibril beta-structure with the unfolded state of alpha-synuclein". ChemBioChem. 8 (14): 1671–4. doi:10.1002/cbic.200700366. PMID 17722123. S2CID 41870508.
  59. ^ Sandal M, Valle F, Tessari I, Mammi S, Bergantino E, Musiani F, et al. (January 2008). "Conformational equilibria in monomeric alpha-synuclein at the single-molecule level". PLOS Biology. 6 (1): e6. doi:10.1371/journal.pbio.0060006. PMC 2174973. PMID 18198943.
  60. ^ Schulz-Schaeffer WJ (August 2010). "The synaptic pathology of alpha-synuclein aggregation in dementia with Lewy bodies, Parkinson's disease and Parkinson's disease dementia". Acta Neuropathologica. 120 (2): 131–43. doi:10.1007/s00401-010-0711-0. PMC 2892607. PMID 20563819.
  61. ^ Morshedi D, Aliakbari F (Spring 2012). "The Inhibitory Effects of Cuminaldehyde on Amyloid Fibrillation and Cytotoxicity of Alpha-synuclein". Modares Journal of Medical Sciences: Pathobiology. 15 (1): 45–60.
  62. ^ Woulfe J, Hoogendoorn H, Tarnopolsky M, Muñoz DG (November 2000). "Monoclonal antibodies against Epstein-Barr virus cross-react with alpha-synuclein in human brain". Neurology. 55 (9): 1398–401. doi:10.1212/WNL.55.9.1398. PMID 11087792. S2CID 84387269.
  63. ^ Polymeropoulos MH, Lavedan C, Leroy E, Ide SE, Dehejia A, Dutra A, et al. (June 1997). "Mutation in the alpha-synuclein gene identified in families with Parkinson's disease". Science. 276 (5321): 2045–7. doi:10.1126/science.276.5321.2045. PMID 9197268.
  64. ^ Krüger R, Kuhn W, Müller T, Woitalla D, Graeber M, Kösel S, et al. (February 1998). "Ala30Pro mutation in the gene encoding alpha-synuclein in Parkinson's disease". Nature Genetics. 18 (2): 106–8. doi:10.1038/ng0298-106. PMID 9462735. S2CID 40777043.
  65. ^ Zarranz JJ, Alegre J, Gómez-Esteban JC, Lezcano E, Ros R, Ampuero I, et al. (February 2004). "The new mutation, E46K, of alpha-synuclein causes Parkinson and Lewy body dementia". Annals of Neurology. 55 (2): 164–73. doi:10.1002/ana.10795. PMID 14755719. S2CID 55263.
  66. ^ Appel-Cresswell S, Vilarino-Guell C, Encarnacion M, Sherman H, Yu I, Shah B, et al. (June 2013). "Alpha-synuclein p.H50Q, a novel pathogenic mutation for Parkinson's disease". Movement Disorders. 28 (6): 811–3. doi:10.1002/mds.25421. PMID 23457019. S2CID 13508258.
  67. ^ Lesage S, Anheim M, Letournel F, Bousset L, Honoré A, Rozas N, et al. (April 2013). "G51D α-synuclein mutation causes a novel parkinsonian-pyramidal syndrome". Annals of Neurology. 73 (4): 459–71. doi:10.1002/ana.23894. PMID 23526723. S2CID 43305127.
  68. ^ Fevga, C; Park, Y; Lohmann, E; Kievit, AJ; Breedveld, GJ; Ferraro, F; de Boer, L; van Minkelen, R; Hanagasi, H; Boon, A; Wang, W; Petsko, GA; Hoang, QQ; Emre, M; Bonifati, V (August 2021). "A new alpha-synuclein missense variant (Thr72Met) in two Turkish families with Parkinson's disease". Parkinsonism & related disorders. 89: 63–72. doi:10.1016/j.parkreldis.2021.06.023. PMID 34229155 Provjerite vrijednost parametra |pmid= (pomoć).
  69. ^ Giasson BI, Uryu K, Trojanowski JQ, Lee VM (March 1999). "Mutant and wild type human alpha-synucleins assemble into elongated filaments with distinct morphologies in vitro". The Journal of Biological Chemistry. 274 (12): 7619–22. doi:10.1074/jbc.274.12.7619. PMID 10075647.
  70. ^ Flagmeier P, Meisl G, Vendruscolo M, Knowles TP, Dobson CM, Buell AK, Galvagnion C (September 2016). "Mutations associated with familial Parkinson's disease alter the initiation and amplification steps of α-synuclein aggregation". Proceedings of the National Academy of Sciences of the United States of America. 113 (37): 10328–33. doi:10.1073/pnas.1604645113. PMC 5027465. PMID 27573854.
  71. ^ Singleton AB, Farrer M, Johnson J, Singleton A, Hague S, Kachergus J, et al. (October 2003). "alpha-Synuclein locus triplication causes Parkinson's disease". Science. 302 (5646): 841. doi:10.1126/science.1090278. PMID 14593171. S2CID 85938327.
  72. ^ Chartier-Harlin MC, Kachergus J, Roumier C, Mouroux V, Douay X, Lincoln S, Levecque C, Larvor L, Andrieux J, Hulihan M, Waucquier N, Defebvre L, Amouyel P, Farrer M, Destée A (2004). "Alpha-synuclein locus duplication as a cause of familial Parkinson's disease". Lancet. 364 (9440): 1167–9. doi:10.1016/S0140-6736(04)17103-1. PMID 15451224. S2CID 54419671.
  73. ^ Eslamboli A, Romero-Ramos M, Burger C, Bjorklund T, Muzyczka N, Mandel RJ, et al. (March 2007). "Long-term consequences of human alpha-synuclein overexpression in the primate ventral midbrain". Brain. 130 (Pt 3): 799–815. doi:10.1093/brain/awl382. PMID 17303591.
  74. ^ Giasson BI, Forman MS, Higuchi M, Golbe LI, Graves CL, Kotzbauer PT, et al. (April 2003). "Initiation and synergistic fibrillization of tau and alpha-synuclein". Science. 300 (5619): 636–40. Bibcode:2003Sci...300..636G. doi:10.1126/science.1082324. PMID 12714745. S2CID 20223000.
  75. ^ Takeda A, Hashimoto M, Mallory M, Sundsumo M, Hansen L, Masliah E (March 2000). "C-terminal alpha-synuclein immunoreactivity in structures other than Lewy bodies in neurodegenerative disorders". Acta Neuropathologica. 99 (3): 296–304. doi:10.1007/PL00007441. PMID 10663973. S2CID 27393027.
  76. ^ Williams T, Sorrentino Z, Weinrich M, Giasson BI, Chakrabarty P (2020-07-01). "Differential cross-seeding properties of tau and α-synuclein in mouse models of tauopathy and synucleinopathy". Brain Communications. 2 (2): fcaa090. doi:10.1093/braincomms/fcaa090. PMC 7567170. PMID 33094280.
  77. ^ Prusiner SB, Woerman AL, Mordes DA, Watts JC, Rampersaud R, Berry DB, et al. (September 2015). "Evidence for α-synuclein prions causing multiple system atrophy in humans with parkinsonism". Proceedings of the National Academy of Sciences of the United States of America. 112 (38): E5308-17. Bibcode:2015PNAS..112E5308P. doi:10.1073/pnas.1514475112. PMC 4586853. PMID 26324905.
  78. ^ Weiler N (31 August 2015). "New Type of Prion May Cause, Transmit Neurodegeneration".
  79. ^ Rettner R (31 August 2015). "Another Fatal Brain Disease May Come from the Spread of 'Prion' Proteins". Wired Science.
  80. ^ Cookson MR (February 2009). "alpha-Synuclein and neuronal cell death". Molecular Neurodegeneration. 4 (1): 9. doi:10.1186/1750-1326-4-9. PMC 2646729. PMID 19193223.
  81. ^ De Giorgi F, Laferrière F, Zinghirino F, Faggiani E, Lends A, Bertoni M, et al. (October 2020). "Novel self-replicating α-synuclein polymorphs that escape ThT monitoring can spontaneously emerge and acutely spread in neurons". Science Advances. 6 (40): eabc4364. Bibcode:2020SciA....6.4364D. doi:10.1126/sciadv.abc4364. PMC 7852382. PMID 33008896.
  82. ^ Fujiwara H, Hasegawa M, Dohmae N, Kawashima A, Masliah E, Goldberg MS, et al. (February 2002). "alpha-Synuclein is phosphorylated in synucleinopathy lesions". Nature Cell Biology. 4 (2): 160–4. doi:10.1038/ncb748. PMID 11813001. S2CID 40155547.
  83. ^ Wersinger C, Sidhu A (April 2003). "Attenuation of dopamine transporter activity by alpha-synuclein". Neuroscience Letters. 340 (3): 189–92. doi:10.1016/S0304-3940(03)00097-1. PMID 12672538. S2CID 54381509.
  84. ^ Lee FJ, Liu F, Pristupa ZB, Niznik HB (April 2001). "Direct binding and functional coupling of alpha-synuclein to the dopamine transporters accelerate dopamine-induced apoptosis". FASEB Journal. 15 (6): 916–26. doi:10.1096/fj.00-0334com. PMID 11292651.
  85. ^ Choi P, Golts N, Snyder H, Chong M, Petrucelli L, Hardy J, et al. (September 2001). "Co-association of parkin and alpha-synuclein". NeuroReport. 12 (13): 2839–43. doi:10.1097/00001756-200109170-00017. PMID 11588587. S2CID 83941655.
  86. ^ Kawahara K, Hashimoto M, Bar-On P, Ho GJ, Crews L, Mizuno H, et al. (March 2008). "alpha-Synuclein aggregates interfere with Parkin solubility and distribution: role in the pathogenesis of Parkinson disease". The Journal of Biological Chemistry. 283 (11): 6979–87. doi:10.1074/jbc.M710418200. PMID 18195004.
  87. ^ Ahn BH, Rhim H, Kim SY, Sung YM, Lee MY, Choi JY, et al. (April 2002). "alpha-Synuclein interacts with phospholipase D isozymes and inhibits pervanadate-induced phospholipase D activation in human embryonic kidney-293 cells" (PDF). The Journal of Biological Chemistry. 277 (14): 12334–42. doi:10.1074/jbc.M110414200. PMID 11821392. S2CID 85695661.
  88. ^ Neystat M, Rzhetskaya M, Kholodilov N, Burke RE (June 2002). "Analysis of synphilin-1 and synuclein interactions by yeast two-hybrid beta-galactosidase liquid assay". Neuroscience Letters. 325 (2): 119–23. doi:10.1016/S0304-3940(02)00253-7. PMID 12044636. S2CID 11517781.
  89. ^ Reed JC, Meister L, Tanaka S, Cuddy M, Yum S, Geyer C, Pleasure D (December 1991). "Differential expression of bcl2 protooncogene in neuroblastoma and other human tumor cell lines of neural origin". Cancer Research. 51 (24): 6529–38. PMID 1742726.
  90. ^ Kawamata H, McLean PJ, Sharma N, Hyman BT (May 2001). "Interaction of alpha-synuclein and synphilin-1: effect of Parkinson's disease-associated mutations". Journal of Neurochemistry. 77 (3): 929–34. doi:10.1046/j.1471-4159.2001.00301.x. PMID 11331421. S2CID 83885937.
  91. ^ Engelender S, Kaminsky Z, Guo X, Sharp AH, Amaravi RK, Kleiderlein JJ, et al. (May 1999). "Synphilin-1 associates with alpha-synuclein and promotes the formation of cytosolic inclusions". Nature Genetics. 22 (1): 110–4. doi:10.1038/8820. PMID 10319874. S2CID 2611127.
  92. ^ Lee VM, Giasson BI, Trojanowski JQ (March 2004). "More than just two peas in a pod: common amyloidogenic properties of tau and alpha-synuclein in neurodegenerative diseases". Trends in Neurosciences. 27 (3): 129–34. doi:10.1016/j.tins.2004.01.007. PMID 15036877. S2CID 9545889.
  93. ^ Jensen PH, Hager H, Nielsen MS, Hojrup P, Gliemann J, Jakes R (September 1999). "alpha-synuclein binds to Tau and stimulates the protein kinase A-catalyzed tau phosphorylation of serine residues 262 and 356". The Journal of Biological Chemistry. 274 (36): 25481–9. doi:10.1074/jbc.274.36.25481. PMID 10464279. S2CID 23877061.
  94. ^ Giasson BI, Lee VM, Trojanowski JQ (2003). "Interactions of amyloidogenic proteins". Neuromolecular Medicine. 4 (1–2): 49–58. doi:10.1385/NMM:4:1-2:49. PMID 14528052. S2CID 9086733.
  95. ^ Ono K, Takahashi R, Ikeda T, Yamada M (September 2012). "Cross-seeding effects of amyloid β-protein and α-synuclein". Journal of Neurochemistry. 122 (5): 883–90. doi:10.1111/j.1471-4159.2012.07847.x. hdl:2297/34736. PMID 22734715. S2CID 17593306.

Dopunska literaturaUredi

Vanjski linkoviUredi

Šablon:Protein nervnog tkiva