CASP9

Kaspaza-9 jest enzim koji je kod ljudi kodiran genom CASP9 sa hromosoma 1. To je pokretač kaspaza,[5] kritičanih za apoptotski put koji se nalazi u mnogim tkivima.[6] Homolozi kaspaze-9 su identifikovani kod svih sisara za koje je poznato da postoje, kao što su Mus musculus i Pan troglodytes.[7]

CASP9
Protein CASP9 PDB 1jxq.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4RHW, 1JXQ, 1NW9, 2AR9, 3D9T, 3V3K, 3YGS

Identifikatori
AliasiCASP9
Vanjski ID-jeviOMIM: 602234 MGI: 1277950 HomoloGene: 31024 GeneCards: CASP9
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za CASP9
Genomska lokacija za CASP9
Bend1p36.21Početak15,490,832 bp[1]
Kraj15,526,534 bp[1]
Lokacija gena (miš)
Hromosom 4 (miš)
Hrom.Hromosom 4 (miš)[2]
Hromosom 4 (miš)
Genomska lokacija za CASP9
Genomska lokacija za CASP9
Bend4|4 D3Početak141,520,923 bp[2]
Kraj141,543,287 bp[2]
Obrazac RNK ekspresije
PBB GE CASP9 210775 x at fs.png

PBB GE CASP9 203984 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija cysteine-type peptidase activity
SH3 domain binding
GO:0070122 peptidase activity
GO:0001948, GO:0016582 protein binding
GO:0010577 enzyme activator activity
hydrolase activity
protein kinase binding
cysteine-type endopeptidase activity involved in execution phase of apoptosis
cysteine-type endopeptidase activity
identical protein binding
cysteine-type endopeptidase activity involved in apoptotic signaling pathway
cysteine-type endopeptidase activity involved in apoptotic process
Ćelijska komponenta citoplazma
citosol
mitohondrija
apoptosome
Jedro
GO:0009327 protein-containing complex
Biološki proces regulation of apoptotic process
response to estradiol
GO:1904578 response to organic cyclic compound
signal transduction in response to DNA damage
cellular response to UV
GO:1904576 response to antibiotic
GO:1904579 cellular response to organic cyclic compound
GO:0010260 Starenje
platelet formation
glial cell apoptotic process
cellular response to dexamethasone stimulus
Proteoliza
cellular response to DNA damage stimulus
response to lipopolysaccharide
positive regulation of neuron apoptotic process
activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c
intrinsic apoptotic signaling pathway in response to DNA damage
extrinsic apoptotic signaling pathway in absence of ligand
regulation of response to DNA damage stimulus
response to cobalt ion
activation of cysteine-type endopeptidase activity involved in apoptotic process
response to UV
execution phase of apoptosis
positive regulation of apoptotic process
GO:0097285 Apoptoza
Nefrogeneza
response to ischemia
leukocyte apoptotic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001229
NM_001278054
NM_032996

NM_001277932
NM_015733
NM_001355176

RefSeq (bjelančevina)

NP_001220
NP_001264983
NP_127463

NP_001264861
NP_056548
NP_001342105

Lokacija (UCSC)Chr 1: 15.49 – 15.53 MbChr 4: 141.52 – 141.54 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Kaspaza-9 pripada porodici kaspaza, cistein-asparaginskih proteaza uključenih u apoptozu i citokinsku signalizaciju.[8] Apoptotski signali uzrokuju oslobađanje citohroma c iz mitohondrija i aktivaciju apaf-1 (apoptosoma), koji zatim cijepa pro-enzim kaspazu-9 u aktivni oblik dimera.[6] Regulacija ovog enzima dešava se putem fosforilacije pomoću alosternih inhibitora, inhibirajući dimerizaciju i izazivajući konformacionu promjenu.[8]

Za apoptozu je potrebna ispravna funkcija kaspaze-9, što dovodi do normalnog razvoja centralnog nervnog sistema.[8] Kaspaza-9 ima višestruke dodatne ćelijske funkcije koje su nezavisne od njene uloge u apoptozi . Neapoptozne uloge kaspaze-9 uključuju regulaciju nekroptoza, ćelijske diferencijacije, urođenog imunskog odgovora, sazrijevanje senzornih neurona, mitohondrijsku homeostazu, organizaciju kortikospinalnog kruga i ishemijsku vaskularnu povredu.[9] Bez ispravne funkcije može doći do abnormalnog razvoja tkiva što dovodi do abnormalne funkcije, bolesti i prerane smrti.[8] Mutacije gubitka funkcije kaspaze-9 povezane su sa imunodeficijencijama/limfoproliferacijom, defektima nervne cijevi i sindromom sličnim Li-Fraumenijevom. Povećana aktivnost kaspaze-9 implicirana je u napredovanju amiotrofne lateralne skleroze, odvajanja mrežnjače i sindroma sporog kanala, kao i raznih drugih neurvnih, autoimunskih i kardiovaskularnih poremećaja.[9]

Različite proteinske izoforme kaspaze-9 nastaju zbog alternativne prerade.[10]

Aminokiselinska sekvencaUredi

Dužina polipeptidnog lanca je 416 aminokiselina, a molekulska težina 46.281 Da.[11]

1020304050
MDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPHMIEDIQRAGSGS
RRDQARQLIIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQAAKLSK
PTLENLTPVVLRPEIRKPEVLRPETPRPVDIGSGGFGDVGALESLRGNAD
LAYILSMEPCGHCLIINNVNFCRESGLRTRTGSNIDCEKLRRRFSSLHFM
VEVKGDLTAKKMVLALLELAQQDHGALDCCVVVILSHGCQASHLQFPGAV
YGTDGCPVSVEKIVNIFNGTSCPSLGGKPKLFFIQACGGEQKDHGFEVAS
TSPEDESPGSNPEPDATPFQEGLRTFDQLDAISSLPTPSDIFVSYSTFPG
FVSWRDPKSGSWYVETLDDIFEQWAHSEDLQSLLLRVANAVSVKGIYKQM
PGCFNFLRKKLFFKTS

StrukturaUredi

Slično drugim kaspazama, kaspaza-9 ima tri domena: N-terminalni prodomen, veliku podjedinicu i malu podjedinicu.[8] N-terminalni prodomen naziva se i dugio prodomen koji sadrži domen aktivacije kaspaze (CARD) motiv.[12] Prodomen povezan je sa katalitskim domenom preko linker petlje.[13]

Kaspazni-9 monomer sastoji se od jedne velike i jedne male podjedinice, a obje sadrže katalitski domen.[14] Za razliku od normalno konzerviranog motiva aktivnog mjesta QACRG u drugim kaspazama, kaspaza-9 ima motiv QACGG.[13][15]

Kada je dimerizirana, kaspaza-9 ima dve različite konformacije aktivnog mesta unutar svakog dimera.[14] Jedno mesto veoma liči na katalitsko mesto drugih kaspaza, dok drugo nema 'aktivacijsku petlju', ometajući katalitski mehanizam na tom određenom aktivnom mestu.[14] Površinske petlje oko aktivnog mesta su kratke, što dovodi do široke specifičnosti supstrata jer je rascep koji se vezuje za supstrat otvoreniji.[16] Unutar aktivnog mjesta kaspaze-9, da bi došlo do katalitske aktivnosti, moraju na pravom mjestu biti specifične aminokiseline. Aminokiselina Asp na poziciji P1 je esencijalna, s preferencijom za aminokiselinu His na poziciji P2.[17]

LokalizacijaUredi

Unutar ćelije, kaspaza-9 kod ljudi se nalazi u mitohondrijama, citosolu i jedru.[18]

Ekspresija proteinaUredi

Kaspaza-9 kod ljudi eksprimirana je u tkivima i fetusa i odraslih.[13][15] Tkivna ekspresija kaspaze-9 je sveprisutna s najvećom ekspresijom u mozgu i srcu, posebno u fazi razvoja odrasle osobe u mišićnim ćelijama srca.[19] Jetra, gušterača i skeletni mišići eksprimiraju ovaj enzim na umjerenom nivou, a sva ostala tkiva eksprimiraju kaspazu-9 na niskim razinama.[19]

MehanizamUredi

Aktivna kaspaza-9 djeluje kao inicirajuća kaspaza cijepanjem, aktivirajući tako izvršne kaspaze nizvodno, inicirajući apoptozu.[20] Kada se aktivira, kaspaza-9 nastavlja da cijepa kaspazu-3, -6 i -7, pokrećući kaskadu kaspaza dok cijepaju nekoliko drugih ćelijskih ciljeva.[8]

Kada je kaspaza-9 neaktivna, ona postoji u citosolu kao zimogen, u svom monomernom obliku.[14][21] Tada se uključuje i aktivira putem CARD-apaf-1, prepoznavajući CARD u kaspazi-9.[22]

PreradaUredi

Prije nego što dođe do aktivacije, kaspaza-9 se mora preraditi.[23] U početku, kaspaza-9 je napravljena kao neaktivni jednolančani zimogen.[23] Procesuiranje se dešava kada se apoptozom veže za pro-kaspazu-9 dok apaf-1 pomaže u autoproteolitskoj preradi zimogena.[23] Obrađena kaspaza-9 ostaje vezana za kompleks apoptosoma, formirajući holoenzim.[24]

AktivacijaUredi

Aktivacija se događa kada se kaspaza-9 dimerizira, a postoje dva različita načina na koja se to može dogoditi:

  1. Kaspaza-9 se automatski aktivira kada se veže za apaf-1 (apoptosom), jer apaf-1 oligomerizira molekule prekursora prokaspase-9.[18]
  2. Prethodno aktivirane kaspaze mogu cijepati kaspazu-9, uzrokujući njenu dimerizaciju.[25]

Katalitska aktivnostUredi

Kaspaza-9 ima preferiranu sekvencu cijepanja Leu-Gly-His-Asp-(cut)-X.[17]

RegulacijaUredi

Negativna regulacija kaspaze-9 se javlja putem fosforilacija.[8] To radi serin-treonin kinaza, Akt, na serinu-196 koji inhibira aktivaciju i aktivnost proteaze kaspaze-9, suzbijanje kaspaze-9 i dalju aktivaciju apoptoze.[26] Akt djeluje kao alosterni inhibitor kaspaze-9 jer je mjesto fosforilacije serina-196 daleko od katalitskog mjesta.[26] Inhibitor utiče na dimerizaciju kaspaze- 9 i uzrokuje konformacijsku promjenu koja utiče na rascjep kaspaze-9 koji se veže na supstrat.[26]

Akt može djelovati i na prerađenu i na neprerađenu kaspazu-9 in vitro, gdje se fosforilacija obrađene kaspaze-9 javlja na velikoj podjedinici.[27]

Nedostaci i mutacijeUredi

Nedostatak kaspaze-9 u velikoj mjeri utiče na mozak i njegov razvoj.[28] Efekti mutacije ili nedostatka ove kaspaze u odnosu na druge su štetni.[28] Početna uloga kaspaze-9 u apoptozi je uzrok teških efekata uočenih kod onih s atipskom kaspazom- 9.

Miševi s nedovoljnom kaspazom-9 imaju glavni fenotip zahvaćenog ili abnormalnog mozga. Akt djeluje kao alosterni inhibitor kaspaze-9 jer je mjesto fosforilacije serina-196 daleko od katalitičkog mjesta.[26] Inhibitor utiče na dimerizaciju kaspaze- 9 i uzrokuje konformacijsku promjenu koja utječe na rascjep kaspaze-9 koji se veže na supstrat.[26]

Akt može djelovati i na obrađenu i na neprerađenu kaspazu-9 in vitro, gdje se fosforilacija obrađene kaspaze-9 javlja na velikoj podjedinici. Veliki mozak utiče na opadanje učestalosi apoptoza, izazivajući porast dodatnih neurona u primjeru fenotipa nedostatka kaspaze-9 kod miševa.[29] Oni homozigoti bez kaspaze-9 uginu perinatalno kao rezultat abnormalno razvijenog cerebruma.[8]

Kod ljudi, ekspresija kaspaze-9 varira od tkiva do tkiva, a različiti nivoi imaju fiziološku ulogu.[29] Niske količine kaspaze-9 dovode do kancera i neurodegenerativne bolesti kao što je Alzheimerova bolest.[29] Daljnje promjene na nivou jednonukleotidnih polimorfizama(SNP) i nivoa cijelog gena kaspaze-9 mogu uzrokovati mutacije zametne linije povezane s ne-Hodgkinovim limfomom.[30] Određeni polimorfizmi u promotoru kaspaze-9 povećavaju brzinu ekspresije kaspaze-9, a to može povećati rizik od karcinoma pluća.[31]

Klinički značajUredi

Efekti abnormalnih nivoa ili funkcije kaspaze-9 utiču na kliničku sliku. Uticaj kaspaze-9 na mozak može dovesti do budućeg rada na inhibiciji kroz ciljanu terapiju, posebno kod bolesti povezanih s mozgom jer ovaj enzim može sudjelovati u razvojnim putevima neuronskih poremećaja.[8]

Uvođenje kaspaza takođe može imati medicinske koristi.[20] U kontekstu bolesti transplantata protiv domaćina, kaspaza-9 može se uvesti kao inducibilni prekidač.[32] U prisustvu male molekule, dimerizirat će se i pokrenuti apoptozu, eliminirajući limfocite.[32]

iCasp9Uredi

iCasp9 (inducibilna kaspaza-9) je tip kontrolnog sistema za himerne T-ćelije receptora antigena (CAR T-ćelije). CAR T-ćelije su genetički modifikovane T-ćelije koje pokazuju citotoksičnost na tumorske ćelije. Dokazi pokazuju da su CAR T-ćelije efikasne u liječenju zloćudnih bolesti B-ćelija. Međutim, kako CAR T-ćelije unose toksičnost, korisnička kontrola ćelija i njihovih meta je kritična.[33] Jedan on ostalih puteva kontrole CAR T-ćelija je putem lijekovima kntroliranogsistema sinteze. iCasp9 nastaje modoficiranjem kaspaze-9 i njenim spajenjem sa FK506 vezujućim proteinom.[33] iCasp9 se može pridodati na CAR T-ćelije kao inducibilni suicidni gen.[34]

Ako terapija CAR T-ćelijama rezultira teškim nuspojavama, iCasp9 se može koristiti za zaustavljanje liječenja. Davanje lijeka s malim molekulama, kao što je rapamicin, uzrokuje da se lijek veže za domen FK506.[34] Ovo zauzvrat inducira ekspresiju kaspaze-9, koja pokreće ćelijsku smrt CAR T-ćelije.[34]

Alternativni transkriptiUredi

Putem alternativne prerade, proizvode se četiri različite kaspaze-9 varijante.

Kaspaza-9α (9L)Uredi

Ova varijanta se koristi kao referentna sekvenca i ima punu aktivnost cistein-proteaze.[12][35]

Kaspaza-9β (9S)Uredi

Izoforma 2 ne uključuje egzone 3, 4, 5 i 6; nedostaju mu aminokiseline 140-289.[12][35] Kaspaza-9S nema centralni katalitski domen, stoga funkcionira kao inhibitor kaspaze-9α, tako što se veže za apoptosom, potiskujući kaskadu enzima kaspaze i apoptozu.[12][36] Kaspaza-9β se naziva endogena dominantno negativna izoforma.

Kaspaza-9γUredi

U ovoj varijanti nedostaju aminokiseline 155-416, a za aminokiseline 152-154, sekvenca AYI je promijenjena u TVL.[35]

Izoforma 4Uredi

U poređenju sa referentnom sekvencom, nedostaju aminokiseline 1-83.[35]

InterakcijeUredi

Pokazalo se da kaspaza-9 reaguje sa:

 
Pregled puteva transdukcije signala uključenih u apoptozu.

Također pogledajteUredi

ReferenceUredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000132906 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000028914 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Caspase 9
  6. ^ a b c Li P, Nijhawan D, Budihardjo I, Srinivasula SM, Ahmad M, Alnemri ES, Wang X (novembar 1997). "Cytochrome c and dATP-dependent formation of Apaf-1/caspase-9 complex initiates an apoptotic protease cascade". Cell. 91 (4): 479–89. doi:10.1016/s0092-8674(00)80434-1. PMID 9390557. S2CID 14321446.
  7. ^ "HomoloGene - NCBI". www.ncbi.nlm.nih.gov. Pristupljeno 1. 12. 2017.
  8. ^ a b c d e f g h i Kuida K (2000). "Caspase-9". The International Journal of Biochemistry & Cell Biology. 32 (2): 121–4. doi:10.1016/s1357-2725(99)00024-2. PMID 10687948.
  9. ^ a b Avrutsky MI, Troy CM (2021). "Caspase-9: A Multimodal Therapeutic Target With Diverse Cellular Expression in Human Disease". Frontiers in Pharmacology. 12: 701301. doi:10.3389/fphar.2021.701301. PMC 8299054 Provjerite vrijednost parametra |pmc= (pomoć). PMID 34305609 Provjerite vrijednost parametra |pmid= (pomoć).
  10. ^ "CASP9 caspase 9 [Homo sapiens (human)] - Gene - NCBI". www.ncbi.nlm.nih.gov. Pristupljeno 30. 11. 2017.
  11. ^ "UniProt, P55211" (jezik: engleski). Pristupljeno 22. 11. 2021.
  12. ^ a b c d Li P, Zhou L, Zhao T, Liu X, Zhang P, Liu Y, Zheng X, Li Q (april 2017). "Caspase-9: structure, mechanisms and clinical application". Oncotarget. 8 (14): 23996–24008. doi:10.18632/oncotarget.15098. PMC 5410359. PMID 28177918.
  13. ^ a b c Srinivasula SM, Fernandes-Alnemri T, Zangrilli J, Robertson N, Armstrong RC, Wang L, Trapani JA, Tomaselli KJ, Litwack G, Alnemri ES (oktobar 1996). "The Ced-3/interleukin 1beta converting enzyme-like homolog Mch6 and the lamin-cleaving enzyme Mch2alpha are substrates for the apoptotic mediator CPP32". The Journal of Biological Chemistry. 271 (43): 27099–106. doi:10.1074/jbc.271.43.27099. PMID 8900201.
  14. ^ a b c d Renatus M, Stennicke HR, Scott FL, Liddington RC, Salvesen GS (decembar 2001). "Dimer formation drives the activation of the cell death protease caspase 9". Proceedings of the National Academy of Sciences of the United States of America. 98 (25): 14250–5. Bibcode:2001PNAS...9814250R. doi:10.1073/pnas.231465798. PMC 64668. PMID 11734640.
  15. ^ a b Duan H, Orth K, Chinnaiyan AM, Poirier GG, Froelich CJ, He WW, Dixit VM (juli 1996). "ICE-LAP6, a novel member of the ICE/Ced-3 gene family, is activated by the cytotoxic T cell protease granzyme B". The Journal of Biological Chemistry. 271 (28): 16720–4. doi:10.1074/jbc.271.28.16720. PMID 8663294.
  16. ^ Thornberry NA, Rano TA, Peterson EP, Rasper DM, Timkey T, Garcia-Calvo M, Houtzager VM, Nordstrom PA, Roy S, Vaillancourt JP, Chapman KT, Nicholson DW (juli 1997). "A combinatorial approach defines specificities of members of the caspase family and granzyme B. Functional relationships established for key mediators of apoptosis". The Journal of Biological Chemistry. 272 (29): 17907–11. doi:10.1074/jbc.272.29.17907. PMID 9218414.
  17. ^ a b Blasche S, Mörtl M, Steuber H, Siszler G, Nisa S, Schwarz F, Lavrik I, Gronewold TM, Maskos K, Donnenberg MS, Ullmann D, Uetz P, Kögl M (14. 3. 2013). "The E. coli effector protein NleF is a caspase inhibitor". PLOS ONE. 8 (3): e58937. Bibcode:2013PLoSO...858937B. doi:10.1371/journal.pone.0058937. PMC 3597564. PMID 23516580.
  18. ^ a b Zhivotovsky B, Samali A, Gahm A, Orrenius S (juli 1999). "Caspases: their intracellular localization and translocation during apoptosis". Cell Death and Differentiation. 6 (7): 644–51. doi:10.1038/sj.cdd.4400536. PMID 10453075.
  19. ^ a b Han Y, Chen YS, Liu Z, Bodyak N, Rigor D, Bisping E, Pu WT, Kang PM (august 2006). "Overexpression of HAX-1 protects cardiac myocytes from apoptosis through caspase-9 inhibition". Circulation Research. 99 (4): 415–23. doi:10.1161/01.RES.0000237387.05259.a5. PMID 16857965.
  20. ^ a b McIlwain DR, Berger T, Mak TW (april 2013). "Caspase functions in cell death and disease". Cold Spring Harbor Perspectives in Biology. 5 (4): a008656. doi:10.1101/cshperspect.a008656. PMC 3683896. PMID 23545416.
  21. ^ McIlwain DR, Berger T, Mak TW (april 2013). "Caspase functions in cell death and disease". Cold Spring Harbor Perspectives in Biology. 5 (4): a008656. doi:10.1101/cshperspect.a008656. PMC 3683896. PMID 23545416.
  22. ^ Acehan D, Jiang X, Morgan DG, Heuser JE, Wang X, Akey CW (2002). "Three-dimensional structure of the apoptosome: implications for assembly, procaspase-9 binding, and activation". Molecular Cell. 9 (2): 423–32. doi:10.1016/s1097-2765(02)00442-2. PMID 11864614.
  23. ^ a b c Hu Q, Wu D, Chen W, Yan Z, Shi Y (maj 2013). "Proteolytic processing of the caspase-9 zymogen is required for apoptosome-mediated activation of caspase-9". The Journal of Biological Chemistry. 288 (21): 15142–7. doi:10.1074/jbc.M112.441568. PMC 3663534. PMID 23572523.
  24. ^ Mace PD, Riedl SJ (decembar 2010). "Molecular cell death platforms and assemblies". Current Opinion in Cell Biology. 22 (6): 828–36. doi:10.1016/j.ceb.2010.08.004. PMC 2993832. PMID 20817427.
  25. ^ Druskovic M, Suput D, Milisav I (decembar 2006). "Overexpression of caspase-9 triggers its activation and apoptosis in vitro". Croatian Medical Journal. 47 (6): 832–40. PMC 2080483. PMID 17167855.
  26. ^ a b c d e Cardone MH, Roy N, Stennicke HR, Salvesen GS, Franke TF, Stanbridge E, Frisch S, Reed JC (novembar 1998). "Regulation of cell death protease caspase-9 by phosphorylation". Science. 282 (5392): 1318–21. Bibcode:1998Sci...282.1318C. doi:10.1126/science.282.5392.1318. PMID 9812896.
  27. ^ Cardone MH, Roy N, Stennicke HR, Salvesen GS, Franke TF, Stanbridge E, Frisch S, Reed JC (novembar 1998). "Regulation of cell death protease caspase-9 by phosphorylation". Science. 282 (5392): 1318–21. Bibcode:1998Sci...282.1318C. doi:10.1126/science.282.5392.1318. PMID 9812896.
  28. ^ a b Madden SD, Cotter TG (februar 2008). "Cell death in brain development and degeneration: control of caspase expression may be key!". Molecular Neurobiology. 37 (1): 1–6. doi:10.1007/s12035-008-8021-4. PMID 18449809. S2CID 12980212.
  29. ^ a b c Hakem R, Hakem A, Duncan GS, Henderson JT, Woo M, Soengas MS, Elia A, de la Pompa JL, Kagi D, Khoo W, Potter J, Yoshida R, Kaufman SA, Lowe SW, Penninger JM, Mak TW (1998). "Differential requirement for caspase 9 in apoptotic pathways in vivo". Cell. 94 (3): 339–52. doi:10.1016/s0092-8674(00)81477-4. PMID 9708736. S2CID 14390544.
  30. ^ Kelly JL, Novak AJ, Fredericksen ZS, Liebow M, Ansell SM, Dogan A, Wang AH, Witzig TE, Call TG, Kay NE, Habermann TM, Slager SL, Cerhan JR (novembar 2010). "Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma". Cancer Epidemiology, Biomarkers & Prevention. 19 (11): 2847–58. doi:10.1158/1055-9965.EPI-10-0581. PMC 2976783. PMID 20855536.
  31. ^ Park JY, Park JM, Jang JS, Choi JE, Kim KM, Cha SI, Kim CH, Kang YM, Lee WK, Kam S, Park RW, Kim IS, Lee JT, Jung TH (juni 2006). "Caspase 9 promoter polymorphisms and risk of primary lung cancer". Human Molecular Genetics. 15 (12): 1963–71. doi:10.1093/hmg/ddl119. PMID 16687442.
  32. ^ a b Straathof KC, Pulè MA, Yotnda P, Dotti G, Vanin EF, Brenner MK, Heslop HE, Spencer DM, Rooney CM (juni 2005). "An inducible caspase 9 safety switch for T-cell therapy". Blood. 105 (11): 4247–54. doi:10.1182/blood-2004-11-4564. PMC 1895037. PMID 15728125.
  33. ^ a b Choe JH, Williams JZ, Lim WA (2020). "Engineering T Cells to Treat Cancer: The Convergence of Immuno-Oncology and Synthetic Biology". Annual Review of Cancer Biology. 4: 121–139. doi:10.1146/annurev-cancerbio-030419-033657.
  34. ^ a b c "Definition of autologous iCASP9-CD19-expressing T lymphocytes". National Cancer Institute. Pristupljeno 2. 7. 2020.
  35. ^ a b c d "CASP9 - Caspase-9 precursor - Homo sapiens (Human) - CASP9 gene & protein". www.uniprot.org. Pristupljeno 1. 12. 2017.
  36. ^ Vu NT, Park MA, Shultz JC, Goehe RW, Hoeferlin LA, Shultz MD, Smith SA, Lynch KW, Chalfant CE (mart 2013). "hnRNP U enhances caspase-9 splicing and is modulated by AKT-dependent phosphorylation of hnRNP L". The Journal of Biological Chemistry. 288 (12): 8575–84. doi:10.1074/jbc.M112.443333. PMC 3605676. PMID 23396972.
  37. ^ a b Chu ZL, Pio F, Xie Z, Welsh K, Krajewska M, Krajewski S, Godzik A, Reed JC (mart 2001). "A novel enhancer of the Apaf1 apoptosome involved in cytochrome c-dependent caspase activation and apoptosis". The Journal of Biological Chemistry. 276 (12): 9239–45. doi:10.1074/jbc.M006309200. PMID 11113115.
  38. ^ Cho DH, Hong YM, Lee HJ, Woo HN, Pyo JO, Mak TW, Jung YK (septembar 2004). "Induced inhibition of ischemic/hypoxic injury by APIP, a novel Apaf-1-interacting protein". The Journal of Biological Chemistry. 279 (38): 39942–50. doi:10.1074/jbc.M405747200. PMID 15262985.
  39. ^ Hu Y, Benedict MA, Wu D, Inohara N, Núñez G (april 1998). "Bcl-XL interacts with Apaf-1 and inhibits Apaf-1-dependent caspase-9 activation". Proceedings of the National Academy of Sciences of the United States of America. 95 (8): 4386–91. Bibcode:1998PNAS...95.4386H. doi:10.1073/pnas.95.8.4386. PMC 22498. PMID 9539746.
  40. ^ Pan G, O'Rourke K, Dixit VM (mart 1998). "Caspase-9, Bcl-XL, and Apaf-1 form a ternary complex". The Journal of Biological Chemistry. 273 (10): 5841–5. doi:10.1074/jbc.273.10.5841. PMID 9488720.
  41. ^ a b c Deveraux QL, Roy N, Stennicke HR, Van Arsdale T, Zhou Q, Srinivasula SM, Alnemri ES, Salvesen GS, Reed JC (april 1998). "IAPs block apoptotic events induced by caspase-8 and cytochrome c by direct inhibition of distinct caspases". The EMBO Journal. 17 (8): 2215–23. doi:10.1093/emboj/17.8.2215. PMC 1170566. PMID 9545235.
  42. ^ Guo Y, Srinivasula SM, Druilhe A, Fernandes-Alnemri T, Alnemri ES (april 2002). "Caspase-2 induces apoptosis by releasing proapoptotic proteins from mitochondria". The Journal of Biological Chemistry. 277 (16): 13430–7. doi:10.1074/jbc.M108029200. PMID 11832478.
  43. ^ Srinivasula SM, Ahmad M, Fernandes-Alnemri T, Litwack G, Alnemri ES (decembar 1996). "Molecular ordering of the Fas-apoptotic pathway: the Fas/APO-1 protease Mch5 is a CrmA-inhibitable protease that activates multiple Ced-3/ICE-like cysteine proteases". Proceedings of the National Academy of Sciences of the United States of America. 93 (25): 14486–91. Bibcode:1996PNAS...9314486S. doi:10.1073/pnas.93.25.14486. PMC 26159. PMID 8962078.
  44. ^ Hlaing T, Guo RF, Dilley KA, Loussia JM, Morrish TA, Shi MM, Vincenz C, Ward PA (mart 2001). "Molecular cloning and characterization of DEFCAP-L and -S, two isoforms of a novel member of the mammalian Ced-4 family of apoptosis proteins". The Journal of Biological Chemistry. 276 (12): 9230–8. doi:10.1074/jbc.M009853200. PMID 11076957.
  45. ^ Rual JF, Venkatesan K, Hao T, Hirozane-Kishikawa T, Dricot A, Li N, Berriz GF, Gibbons FD, Dreze M, Ayivi-Guedehoussou N, Klitgord N, Simon C, Boxem M, Milstein S, Rosenberg J, Goldberg DS, Zhang LV, Wong SL, Franklin G, Li S, Albala JS, Lim J, Fraughton C, Llamosas E, Cevik S, Bex C, Lamesch P, Sikorski RS, Vandenhaute J, Zoghbi HY, Smolyar A, Bosak S, Sequerra R, Doucette-Stamm L, Cusick ME, Hill DE, Roth FP, Vidal M (oktobar 2005). "Towards a proteome-scale map of the human protein-protein interaction network". Nature. 437 (7062): 1173–8. Bibcode:2005Natur.437.1173R. doi:10.1038/nature04209. PMID 16189514. S2CID 4427026.
  46. ^ Davoodi J, Lin L, Kelly J, Liston P, MacKenzie AE (septembar 2004). "Neuronal apoptosis-inhibitory protein does not interact with Smac and requires ATP to bind caspase-9". The Journal of Biological Chemistry. 279 (39): 40622–8. doi:10.1074/jbc.M405963200. PMID 15280366.
  47. ^ Richter BW, Mir SS, Eiben LJ, Lewis J, Reffey SB, Frattini A, Tian L, Frank S, Youle RJ, Nelson DL, Notarangelo LD, Vezzoni P, Fearnhead HO, Duckett CS (juli 2001). "Molecular cloning of ILP-2, a novel member of the inhibitor of apoptosis protein family". Molecular and Cellular Biology. 21 (13): 4292–301. doi:10.1128/MCB.21.13.4292-4301.2001. PMC 87089. PMID 11390657.

Dopunska literaturaUredi

Vanjski linkoviUredi

  • The MEROPS online database for peptidases and their inhibitors: C14.010

Šablon:Fas apoptozni signalni put Šablon:Cistein-proteaze