Alfa 1 protein međućelijske veze

Međuprostorni spojni protein alfa-1 (GJA1), poznat i kao koneksin 43' (GJA1) i Cx43, jest protein koji je kod ljudi kodiran genom GJA1 sa hromosoma 6.[5][6][7] Kao koneksin, GJA1 je komponenta uskih veza, koje omogućavaju spajanje praznina međićeliskih komunikacija (GJIC) između ćelija za regulaciju ćelijske smrti, proliferacije i diferencijacije.[8] Kao rezultat svoje funkcije, GJA1 je uključen u mnoge biološke procese, uključujući kontrakciju mišića, embrionnski razvoj, upale i spermatogenezu, kao i bolesti, uključujući okulodentodigitalnu displaziju (ODDD), srčane malformacije i karcinom.[7][9][10]

Alfa 1 protein međućelijske veze
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2LL2

Identifikatori
AliasiGJA1
Vanjski ID-jeviOMIM: 121014 MGI: 95713 HomoloGene: 136 GeneCards: GJA1
Lokacija gena (čovjek)
Hromosom 6 (čovjek)
Hrom.Hromosom 6 (čovjek)[1]
Hromosom 6 (čovjek)
Genomska lokacija za Alfa 1 protein međućelijske veze
Genomska lokacija za Alfa 1 protein međućelijske veze
Bend6q22.31Početak121,435,595 bp[1]
Kraj121,449,727 bp[1]
Lokacija gena (miš)
Hromosom 10 (miš)
Hrom.Hromosom 10 (miš)[2]
Hromosom 10 (miš)
Genomska lokacija za Alfa 1 protein međućelijske veze
Genomska lokacija za Alfa 1 protein međućelijske veze
Bend10 B4|10 28.64 cMPočetak56,253,426 bp[2]
Kraj56,278,609 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija gap junction channel activity involved in cardiac conduction electrical coupling
gap junction channel activity involved in cell communication by electrical coupling
protein domain specific binding
SH3 domain binding
ion transmembrane transporter activity
PDZ domain binding
GO:0022891 transmembrane transporter activity
GO:0001948, GO:0016582 protein binding
connexin binding
gap junction channel activity
signal transducer activity
disordered domain specific binding
Ćelijska komponenta citoplazma
endozom
membrana
focal adhesion
mitohondrija
multivesicular body
mitochondrial outer membrane
Endoplazmatski retikulum
Lipidni splav
Lizozom
fascia adherens
Egzosom
integral component of membrane
late endosome
Golđijev aparat
Ćelijska membrana
early endosome
gap junction
Golgi-associated vesicle membrane
endoplasmic reticulum membrane
Golđijeva membrana
integral component of plasma membrane
međućelijske veze
connexin complex
Interkalirani disk
Biološki proces Mišićna kontrakcija
GO:1903364 positive regulation of protein catabolic process
regulation of bicellular tight junction assembly
cell communication
cellular response to mechanical stimulus
vascular transport
gap junction assembly
positive regulation of cell communication by chemical coupling
negative regulation of wound healing
negative regulation of cell population proliferation
GO:0097285 Apoptoza
heart development
negative regulation of cell growth
positive regulation of vasoconstriction
positive regulation of glomerular filtration
negative regulation of cardiac muscle cell proliferation
chronic inflammatory response
neuron projection morphogenesis
response to glucose
response to fluid shear stress
atrial cardiac muscle cell action potential
transmembrane transport
positive regulation of behavioral fear response
negative regulation of DNA biosynthetic process
positive regulation of insulin secretion
regulation of calcium ion transport
ATP transport
positive regulation of cytosolic calcium ion concentration
cell-cell signaling
cell communication by electrical coupling involved in cardiac conduction
response to peptide hormone
negative regulation of endothelial cell proliferation
ion transmembrane transport
protein complex oligomerization
endothelium development
response to pH
positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0072468 Transdukcija signala
response to ischemia
response to lipopolysaccharide
response to retinoic acid
decidualization
cell communication by electrical coupling
epididymis development
regulation of transmembrane transporter activity
cellular response to parathyroid hormone stimulus
GO:0015915 transport
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000165

NM_010288

RefSeq (bjelančevina)

NP_000156

NP_034418

Lokacija (UCSC)Chr 6: 121.44 – 121.45 MbChr 10: 56.25 – 56.28 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Koneksin 43
Karboksilni terminalni domen koneksina 43
Identifikatori
SimbolGJA1

Aminokiselinska sekvenca uredi

Dužina polipeptidnog lanca je of 382 aminokiseline, a molekulska težina 43 kDa.[7]

1020304050
MGDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQS
AFRCNTQQPGCENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVM
RKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIEEHGKVKMRGG
LLRTYIISILFKSIFEVAFLLIQWYIYGFSLSAVYTCKRDPCPHQVDCFL
SRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVKGKSDPYHAT
SGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRN
YNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAG
HELQPLAIVDQRPSSRASSRASSRPRPDDLEI

Struktura uredi

GJA1 je 43,0 kDa protein sastavljen od 382 aminokiseline.[11] GJA1 sadrži dugi C-terminalni rep, [N-kraj|[N-terminalni]] domen i višestruke transmembranske domene. Protein prolazi kroz fosfolipidni dvosloj četiri puta, ostavljajući njegove C- i N-terminale izložene citoplazmi.[12] C-terminalni rep sastoji se od 50 aminokiselina i uključuje posttranslacijski mosificirana mjesta, kao i mjesta vezivanja za transkripcijski faktor, citoskeletne elemente i ostale proteine.[12][13] Kao posljedica toga, C-terminalni rep je centralan za funkcije kao što su regulacija pH vrijednosti i sklapanje kanala. Značajno je da je DNK regija "GJA1" gena koji kodira ovaj rep visoko konzervirana, što ukazuje da je ili otporan na mutacije ili postaje smrtonosan kada mutira. U međuvremenu, N-terminalni domen je uključen u prilazkanala i oligomerizaciju i stoga može kontrolirati prebacivanje između otvorenog i zatvorenog stanja kanala. Transmembranski domeni formiraju kanal spajanja jaza, dok vanćelijske petlje olakšavaju pravilno spajanje kanala. Štaviše, dvije vanćelijske petlje formiraju disulfidne veze koje stupaju u interakciju sa dva heksamera kako bi formirale potpuni kanal za spajanje mdeđuprostora.[12]

Koneksin-43 interno ulazno mjesto ribosoma je RNK element prisutan u 5' UTR iRNK GJA1. Ovo interno mjesto ulaska ribosoma (IRES) omogućava nezavisno translatira tokom uslova kao što su toplotni šok i stres.[14]

Interno ulazno mjesto ribosoma (IRES) koneksina-43
 
Identifikatori
SimbolIRES-Cx43

Funkcija uredi

 
Distribucija koneksina 43 u miokardu pacova (spojnice između kardiomiocita)

Kao član porodice koneksina, GJA1 je komponenta uski spojevi, koji su međućelijski kanali koji povezuju susjedne ćelije, kako bi omogućili razmjenu molekula niske molekulske težine, kao što su mali ioni i sekundarni glasnici, za održavanje homeostaze.[7][12][15]

GJA1 je najrašireniji koneksin i detektuje se u većini tipova ćelija.[7][9][12] To je glavni protein u srčanim prazninama i navodno ima ključnu ulogu u sinhroniziranoj kontrakciji srca.[7] Uprkos svojoj ključnoj ulozi u srcu i drugim vitalnim organima, GJA1 ima kratak poluživot (samo dva do četiri sata), što ukazuje na to da se protein svakodnevno podvrgava ćelijskom transportu u srcu i može biti u velikom obilju ili nadoknađen drugim koneksinima.[12] GJA1 je također u velikoj mjeri uključen u embrionski razvoj.[7][8] Naprimjer, uočeno je da transformirajući faktor rasta-beta 1 (TGF-β1) inducira ekspresiju GJA1 preko Smad i ERK1/2 signalnih puteva, što je rezultiralo diferencijacijom trofoblastnih ćelija u placenti.[8]

Nadalje, GJA1 je eksprimiran u mnogim imunskim ćelijama, kao što su eozinofili i T-ćelije, gdje njegova funkcija spajanja jaza potiče sazrijevanje i aktivaciju ovih ćelija i, prema tome, unakrsna komunikacija neophodna za montiranje upalnog odgovora.[10]

Osim toga, GJA1 se može naći u Leydigovim ćelijama i semenifernim tubulama između Sertolijevih ćelija i spermatogonija ili primarnih spermatocita, gdje ima ključnu ulogu u razvoju spermatogeneze i sjemenika, kontrolom čvrstih spojeva proteina u barijeri krvi i testisa. Iako je protein kanala, GJA1 takođe može obavljati funkcije nezavisne od kanala. U citoplazmi, protein reguliše mrežu mikrotubula i, prema tome, migraciju ćelija i polarnost.[9][13] Ova funkcija je uočena u razvoju mozga i srca, kao i zarastanje rana u endotelnim ćelijama.[13] GJA1 je također primećen da se lokalizuje u mitohondrijama, gde promoviše opstanak ćelija tako što reguliše unutrašnji apoptotski put tokom stanja zvanog oksidativni stres.[15]

Klinički značaj uredi

Mutacije u ovom genu povezane su sa ODDD; kraniometafizna displazija; sindrom iznenadne smrti dojenčadi, koji je povezan sa srčanom aritmijom,Hallermann-Streiffovim sindromom i srčanim malformacijama, kao što je viscero-pretkomorska heterotaksija.[7][9][12][16] Bilo je i nekoliko slučajeva prijavljenih gubitaka sluha i kožnih poremećaja koji nisu povezani sa ODDD-om.[12] U konačnici, GJA1 ima nisku toleranciju na odstupanja od svoje originalne sekvence, sa mutacijama koje rezultiraju gubitkom ili dobijanjem funkcije kanala koje dovode do fenotipova bolesti.[12] Paradoksalno je, međutim, da pacijenti sa nizom somatskih mutacija u GJA1 najčešće nemaju srčanu aritmije, iako je koneksin-43 najzastupljeniji protein koji formira pore uskih međućelijskih veza u kardiomiocitima i neophodan je za normalnu propagaciju akcijskog potencijala.[17]

Značajno je da je ekspresija GJA1 povezana sa širokim spektrom karcinoma, uključujući rak nazofarinksa, meningiom, hemangiopericitom, tumor jetre, rak debelog crijeva, rak jednjaka, rak dojke, mezoteliom, glioblastom, rak pluća, adrenokorteksni tumor, rak bubrežnih ćelija, cerviksni karcinom, rak jajnika, rak endometrija, rak prostate, rak štitnjače i karcinom testisa.[9] Smatralo se da njegova uloga u kontroli ćelijske pokretljivosti i polarnosti doprinosi razvoju raka i metastaza, iako može biti uključena i njegova uloga kao proteina spojnice međućelijskih veza.[9][15] Štaviše, citoprotektivni efekti ovog proteina mogu promovirati preživljavanje tumorskih ćelija u radioterapijskim tretmanima, dok utišavanje njegovog gena povećava radioosjetljivost. Kao rezultat toga, GJA1 može poslužiti kao cilj za poboljšanje uspjeha radioterapijskog liječenja raka.[15] Kao biomarker, GJA1 bi se također mogao koristiti za skrining mladih muškaraca na rizik od raka testisa.[9]

Tiroidni hormon trijodtironin (T3) smanjuje ekspresiju GJA1. Pretpostavlja se da je ovo ključni mehanizam zašto je brzina provodljivosti u tkivu miokarda smanjena kod tireotoksikoza, čime se promoviše srčana aritmija.[18]

Do sada, samo rotigaptid, antiaritmički lijek na bazi peptida, i njegovi derivat, kao što je danegaptid, su dosegli klinička ispitivanja za liječenje srčanih patologija povećanjem ekspresije GJA1. Alternativno, lijekovi mogu ciljati komplementarne koneksine, kao što je Cx40, koji funkcionišu slično kao GJA1. Međutim, oba pristupa i dalje zahtijevaju sistem za ciljanje oboljelog tkiva, kako bi se izbjeglo izazivanje razvojnih abnormalnosti na drugom mjestu.[12] Dakle, efikasniji pristup podrazumijeva dizajniranje miRNK pomoću antisens oligonukleotida transfekcijama ili infekcijama da se uništi samo mutantna GJA1 iRNK, čime se omogućava ekspresija divljeg tipa GJA1 i zadržava normalan fenotip.[9][12]

Interakcije uredi

Pokazalo se da protein međućelijskih veza, alfa 1 ima reakcije sa:

Također pogledajte uredi

Reference uredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000152661 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000050953 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Boyadjiev SA, Jabs EW, LaBuda M, Jamal JE, Torbergsen T, Ptácek LJ, Rogers RC, Nyberg-Hansen R, Opjordsmoen S, Zeller CB, Stine OC, Stalker HJ, Zori RT, Shapiro RE (maj 1999). "Linkage analysis narrows the critical region for oculodentodigital dysplasia to chromosome 6q22-q23". Genomics. 58 (1): 34–40. doi:10.1006/geno.1999.5814. PMID 10331943.
  6. ^ Fishman GI, Eddy RL, Shows TB, Rosenthal L, Leinwand LA (maj 1991). "The human connexin gene family of gap junction proteins: distinct chromosomal locations but similar structures". Genomics. 10 (1): 250–256. doi:10.1016/0888-7543(91)90507-B. PMID 1646158.
  7. ^ a b c d e f g h "Entrez Gene: GJA1 gap junction protein, alpha 1, 43kDa".
  8. ^ a b c Cheng JC, Chang HM, Fang L, Sun YP, Leung PC (Jul 2015). "TGF-β1 up-regulates connexin43 expression: a potential mechanism for human trophoblast cell differentiation". Journal of Cellular Physiology. 230 (7): 1558–1566. doi:10.1002/jcp.24902. PMID 25560303. S2CID 28968035.
  9. ^ a b c d e f g h Chevallier D, Carette D, Segretain D, Gilleron J, Pointis G (Apr 2013). "Connexin 43 a check-point component of cell proliferation implicated in a wide range of human testis diseases". Cellular and Molecular Life Sciences. 70 (7): 1207–1220. doi:10.1007/s00018-012-1121-3. PMID 22918484. S2CID 11855947.
  10. ^ a b Vliagoftis H, Ebeling C, Ilarraza R, Mahmudi-Azer S, Abel M, Adamko D, Befus AD, Moqbel R (2014). "Connexin 43 expression on peripheral blood eosinophils: role of gap junctions in transendothelial migration". BioMed Research International. 2014: 803257. doi:10.1155/2014/803257. PMC 4109672. PMID 25110696.
  11. ^ "Protein sequence of human GJA1 (Uniprot ID: P17302)". Cardiac Organellar Protein Atlas Knowledgebase (COPaKB). Arhivirano s originala, 5. 10. 2015. Pristupljeno 18. 9. 2015. Nepoznati parametar |QType= zanemaren (pomoć)
  12. ^ a b c d e f g h i j k l m n Laird DW (Apr 2014). "Syndromic and non-syndromic disease-linked Cx43 mutations". FEBS Letters. 588 (8): 1339–1348. doi:10.1016/j.febslet.2013.12.022. PMID 24434540. S2CID 20651016.
  13. ^ a b c Kameritsch P, Pogoda K, Pohl U (Aug 2012). "Channel-independent influence of connexin 43 on cell migration". Biochimica et Biophysica Acta (BBA) - Biomembranes. 1818 (8): 1993–2001. doi:10.1016/j.bbamem.2011.11.016. PMID 22155212.
  14. ^ Schiavi A, Hudder A, Werner R (Dec 1999). "Connexin43 mRNA contains a functional internal ribosome entry site". FEBS Letters. 464 (3): 118–122. doi:10.1016/S0014-5793(99)01699-3. PMID 10618489. S2CID 26020820.
  15. ^ a b c d Ghosh S, Kumar A, Chandna S (Jul 2015). "Connexin-43 downregulation in G2/M phase enriched tumour cells causes extensive low-dose hyper-radiosensitivity (HRS) associated with mitochondrial apoptotic events". Cancer Letters. 363 (1): 46–59. doi:10.1016/j.canlet.2015.03.046. PMID 25843295.
  16. ^ Pizzuti A, Flex E, Mingarelli R, Salpietro C, Zelante L, Dallapiccola B (Mar 2004). "A homozygous GJA1 gene mutation causes a Hallermann-Streiff/ODDD spectrum phenotype". Human Mutation. 23 (3): 286. doi:10.1002/humu.9220. PMID 14974090. S2CID 13345970.
  17. ^ Delmar M, Makita N (maj 2012). "Cardiac connexins, mutations and arrhythmias". Current Opinion in Cardiology. 27 (3): 236–241. doi:10.1097/HCO.0b013e328352220e. PMID 22382502. S2CID 205620477.
  18. ^ Müller P, Leow MK, Dietrich JW (2022). "Minor perturbations of thyroid homeostasis and major cardiovascular endpoints-Physiological mechanisms and clinical evidence". Frontiers in Cardiovascular Medicine. 9: 942971. doi:10.3389/fcvm.2022.942971. PMID 36046184 Provjerite vrijednost parametra |pmid= (pomoć).
  19. ^ Cameron SJ, Malik S, Akaike M, Lerner-Marmarosh N, Yan C, Lee JD, Abe J, Yang J (maj 2003). "Regulation of epidermal growth factor-induced connexin 43 gap junction communication by big mitogen-activated protein kinase1/ERK5 but not ERK1/2 kinase activation". The Journal of Biological Chemistry. 278 (20): 18682–18688. doi:10.1074/jbc.M213283200. PMID 12637502.
  20. ^ Schubert AL, Schubert W, Spray DC, Lisanti MP (maj 2002). "Connexin family members target to lipid raft domains and interact with caveolin-1". Biochemistry. 41 (18): 5754–5764. doi:10.1021/bi0121656. PMID 11980479.
  21. ^ Giepmans BN, Moolenaar WH (1998). "The gap junction protein connexin43 interacts with the second PDZ domain of the zona occludens-1 protein". Current Biology. 8 (16): 931–934. doi:10.1016/S0960-9822(07)00375-2. PMID 9707407. S2CID 6434044.
  22. ^ Cooper CD, Lampe PD (Nov 2002). "Casein kinase 1 regulates connexin-43 gap junction assembly". The Journal of Biological Chemistry. 277 (47): 44962–44968. doi:10.1074/jbc.M209427200. PMID 12270943.
  23. ^ Giepmans BN, Feiken E, Gebbink MF, Moolenaar WH (2003). "Association of connexin43 with a receptor protein tyrosine phosphatase". Cell Communication & Adhesion. 10 (4–6): 201–205. doi:10.1080/cac.10.4-6.201.205. PMID 14681016.

Dopunska literatura uredi

Vanjski linkovi uredi