FECH (gen)

Ferohelataza ili protoporfirin-ferohelataza je enzim koji je kod ljudi kodiran genom FECH.[5]

FECH
Protein FECH PDB 1hrk.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4MK4, 1HRK, 2HRC, 2HRE, 2PNJ, 2PO5, 2PO7, 2QD1, 2QD2, 2QD3, 2QD4, 2QD5, 3AQI, 3HCN, 3HCO, 3HCP, 3HCR, 3W1W, 4F4D, 4KLA, 4KLC, 4KLR, 4KMM

Identifikatori
AliasiFECH
Vanjski ID-jeviOMIM: 612386 MGI: 95513 HomoloGene: 113 GeneCards: FECH
Lokacija gena (čovjek)
Hromosom 18 (čovjek)
Hrom.Hromosom 18 (čovjek)[1]
Hromosom 18 (čovjek)
Genomska lokacija za FECH
Genomska lokacija za FECH
Bend18q21.31Početak57,544,377 bp[1]
Kraj57,586,732 bp[1]
Lokacija gena (miš)
Hromosom 18 (miš)
Hrom.Hromosom 18 (miš)[2]
Hromosom 18 (miš)
Genomska lokacija za FECH
Genomska lokacija za FECH
Bend18 E1|18 37.43 cMPočetak64,452,914 bp[2]
Kraj64,490,251 bp[2]
Obrazac RNK ekspresije
PBB GE FECH 203116 s at fs.png

PBB GE FECH 203115 at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija iron-sulfur cluster binding
metal ion binding
GO:0001948 protein binding
ferrochelatase activity
lyase activity
ferrous iron binding
2 iron, 2 sulfur cluster binding
Ćelijska komponenta membrana
mitochondrial matrix
mitochondrial inner membrane
mitohondrija
Biološki proces response to platinum ion
response to light stimulus
response to metal ion
response to arsenic-containing substance
generation of precursor metabolites and energy
cellular response to dexamethasone stimulus
porphyrin-containing compound biosynthetic process
response to lead ion
protoporphyrinogen IX metabolic process
response to insecticide
response to methylmercury
response to ethanol
response to drug
heme biosynthetic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000140
NM_001012515
NM_001371094
NM_001371095
NM_001374778

NM_007998
NM_001348055

RefSeq (bjelančevina)

NP_000131
NP_001012533
NP_001358023
NP_001358024
NP_001361707

NP_001334984
NP_032024

Lokacija (UCSC)Chr 18: 57.54 – 57.59 MbChr 18: 64.45 – 64.49 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Ferohelataza
Human Ferrochelatase 2 angstrom crystal structure.png
Ljudska ferohelataza}
Identifikatori
EC broj4.99.1.1
CAS broj9012-93-5
Baze podataka
IntEnzIntEnz pregled
BRENDABRENDA unos
ExPASyNiceZyme pregled
KEGGKEGG unos
MetaCycmetabolički put
PRIAMprofil
PDB struktureRCSB PDB PDBj PDBe PDBsum
Ontologija genaAmiGO / QuickGO
Pretraga
PMCčlanci
PubMedčlanci
NCBIproteini
Ferohelataza
Identifikatori
SimbolFerohelataza
PfamPF00762
InterProIPR001015
PROSITEPDOC00462
SCOP21ak1 / SCOPe / SUPFAM
OPM superporodica129
OPM protein1hrk
Dostupne proteinske strukture:
Pfam  strukture / ECOD  
PDBRCSB PDB; PDBe; PDBj
PDBsumsažetak strukture
Hemeb-formation.svg

FunkcijaUredi

 
Sažetak biosinteze hema B: neke reakcije javljaju se u citoplazmi, a neke u mitohondrijama (žuto)

Ferohelataza katalizira umetanje fero-gvožđa u protoporfirin IX, na putu biosinteze hema da bi se stvorio hem B. Enzim je lokaliziran na unutrašnjoj strani mitohondrijske membrane okrenute ka matriksu. Ferohelataza je najpoznatiji član porodice enzima koji tetrapirolnim strukturama dodaju dvovalentni metalni kation.[6] Naprimjer, u prvom koraku biosinteze bakteriohlorofila, magnezij-helataza dodaje magnezij protoporfirinu IX.[7]

Hem B je bitan kofaktor u mnogim proteinima i enzimima. Konkretno, hem b ima ključnu ulogu kao nosač kisika u hemoglobinu u crvenim krvnim zrncima i mioglobinu u mišićnim ćelijama. Nadalje, hem B se nalazi u citohromu b, ključnoj komponent u Q-citohromu s oksidoreduktazom (kompleks III) u oksidativnoj fosforilaciji.[8]

StrukturaUredi

LjudsKa ferohelataza je homodimer, sastavljen od dva polipeptidna lanca od 359 aminokiselina. Ima ukupnu molekulsku masu od 85,07 kDa.[9] Svaka podjedinica sastoji se od pet regija: sekvenca lokalizacije mitohondrija, N-terminalni domen, dva presavijena domena i C-terminalna ekstenzija. Ostaci 1–62 tvore mitohondrijski lokalizacijski domen, koji se cijepa u postranslacijskim modifikacijama. Preklopljeni domeni sadrže ukupno 17 α-helika i osam β-listova. Produžetak C-kraja sadrži tri od četiri cisteinska ostatka (Cys403, Cys406, Cys411), koji koordiniraju katalizu klaster gvožđe-sumpor (2Fe-2S). Četvrti koordinirajući cistein nalazi se u N-terminalnom domenu (Cys196).[10]

Aktivni džep feroheltaze sastoji se od dvije hidrofobne "usne" i hidrofilne unutrašnjosti. Hidrofobne usne, koje se sastoje od visoko konzerviranih ostataka 300-311, okrenute su prema unutrašnjoj mitohondrijskoj membrani i olakšavaju prolaz slabo topivog supstrata protoporfirina IX i hema kroz membranu. Unutrašnjost džepa na aktivnom mjestu sadrži visoko konzerviranu kiselu površinu koja olakšava ekstrakciju protona iz protoporfirina. Histidin i aspartat ostaju otprilike 20 angstrema iz središta aktivnog mjesta, na mitohondrijskoj strani matrice enzima koji koordinira vezanje metala.[10]

Aminokiselinska sekvenca
Simboli
1020304050
MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETA
QHAQGAKPQVQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMT
LPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDEL
SPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTG
SSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPL
EKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLV
WQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDI
EYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLT
LSCPLCVNPVCRETKSFFTSQQL

MehanizamUredi

 
Protoporfirin IX s pirolskim prstenovima

Ferohelataza katalizira osmi i završni korak u biosintezi hema, pretvarajući protoporfirin IX u hem B. Katalizira reakciju:

protoporfirin + Fe+2hem B + 2 H+

Mehanizam metalacije ljudskog protoporfirina i dalje se istražuje. Mnogi pretpostavljaju da je izobličenje makrocikla porfirina ključno za katalizu. Oni koji proučavaju ferohelatazu Bacillus subtilis predlažu mehanizam za umetanje gvožđa u protoporfirin, u kojem enzim čvrsto zahvata prstenove B, C i D dok savija prsten A 36o. Normalno planarno, ovo izobličenje izlaže usamljeni par elektrona na dušiku u prstenu A ionu Fe+2.[6] Naknadna istraživanje otkrilo je 100o izobličenja u protoporfirinu vezanom za ljudsku ferohelatazu. Za određivanje tipa izobličenja, neophodan je visoko konzervirani histidinski ostatak (His183 u B. subtilis , His263 kod ljudi), kao i kao početni akceptor protona iz protoporfirina.[10][11] Anionski ostaci čine put koji olakšava odmicanje protona od katalitskog histidina.[10] Frataksin šaperonira gvožđe na matričnu stranu ferohelataze, gdje ostaci aspartata i histidina na oba proteina koordiniraju njegov prenos u ferohelatazu.[12] Dva ostatka arginina i tirozina na aktivnom mjestu (Arg164, Tyr165) mogu izvršiti konačnu metalaciju.[10]

 
Aktivno mjesto ferohelataze sa supstratom protoporfirina IX u zelenoj boji. Prikazani ostaci su: hidrofobne grupe koje sadrže protoporfirin IX (žuta), anionski put prenosa protona (tamnoplava), ostaci metalacije (cijan), katalitski histidin (crvena).

Klinički značajUredi

Defekti u ferohelatazi stvaraju nakupinu protoporfirina IX, uzrokujući eritropoetsku protoporfiriju (EPP).[13] Bolest može biti rposljedica različitih mutacija FECH-a, od kojih se većina ponaša po autosomno dominantnom obrascu nasljeđivanja, sa niskom kliničkom penetracijom. Klinički, pacijenti s EPP-om imaju niz simptoma, od asimptomatskih do krajnje bolnih fotosenzibilnosti. U manje od pet posto slučajeva akumulacija protoporfirina u jetri rezultira holestazom (blokada protoka žuči iz jetre u tanko crijevo) i terminalnom otkazivanju jetre.[14]

U slučajevima trovanja olovom, olovo inhibira aktivnost ferohelataze, dijelom rezultirajući porfirijom.[15]

InterakcijeUredi

Ferohelataza komunicira s brojnim drugim enzimima koji su uključeni u biosintezu hema, katabolizam i transport, uključujući protoporfirinogen oksidazu, 5-aminolevulinat sintazu, ABCB10, ABCB7, sukcinil-CoA sintetazu,[16] i mitoferin-1.[17] Više studija sugeriralo je postojanje oligomernog kompleksa, koji omogućava kanaliziranje supstrata i koordinaciju ukupnog metabolizma gvožđa i porfirina u ćeliji.[16][17] N-metilmezoporfirin (N-MeMP) je konkurentni inhibitor s protoporfirinom IX i smatra se analogom u prijelaznom stanju. Kao takav, N-MeMP se intenzivno koristi kao stabilizujući ligand za određivanje rendgenskokristalografske strukture.[18] Frataksin djeluje kao Fe+2 šaperon i kompleksira sa ferohelatazom na njegovoj strani mitohondrijskog matriksa.[12] Ferohelataza može ubaciti i druge dvovalentne metalne ione u protoporfirin. Neki ioni, kao što su Zn+2, Ni i Co formiraju druge metaloporfirine, dok ioni težih metala poput Mn, Pb, Hg i Cd inhibiraju oslobađanje proizvoda nakon metalacije.[19]

Također pogledajteUredi

ReferenceUredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000066926 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000024588 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ https://www.uniprot.org/uniprot/P22830
  6. ^ a b Lecerof, D.; Fodje, M.; Hansson, A.; Hansson, M.; Al-Karadaghi, S. (mart 2000). "Structural and mechanistic basis of porphyrin metallation by ferrochelatase". Journal of Molecular Biology. 297 (1): 221–232. doi:10.1006/jmbi.2000.3569. PMID 10704318.
  7. ^ Leeper, F. J. (1985). "The biosynthesis of porphyrins, chlorophylls, and vitamin B12". Natural Product Reports. 2 (1): 19–47. doi:10.1039/NP9850200019. PMID 3895052.
  8. ^ Berg, Jeremy; Tymoczko, John; Stryer, Lubert (2012). Biochemistry (7th izd.). New York: W.H. Freeman. ISBN 9781429229364.
  9. ^ http://www.rcsb.org/pdb/explore/explore.do?structureId=1HRK
  10. ^ a b c d e Wu, Chia-Kuei; Dailey, Harry A.; Rose, John P.; Burden, Amy; Sellers, Vera M.; Wang, Bi-Cheng (1. 2. 2001). "The 2.0 Å structure of human ferrochelatase, the terminal enzyme of heme biosynthesis". Nature Structural Biology. 8 (2): 156–160. doi:10.1038/84152. PMID 11175906. S2CID 9822420.
  11. ^ Karlberg, Tobias; Hansson, Mattias D.; Yengo, Raymond K.; Johansson, Renzo; Thorvaldsen, Hege O.; Ferreira, Gloria C.; Hansson, Mats; Al-Karadaghi, Salam (maj 2008). "Porphyrin Binding and Distortion and Substrate Specificity in the Ferrochelatase Reaction: The Role of Active Site Residues". Journal of Molecular Biology. 378 (5): 1074–1083. doi:10.1016/j.jmb.2008.03.040. PMC 2852141. PMID 18423489.
  12. ^ a b Bencze, Krisztina Z.; Yoon, Taejin; Mill?n-Pacheco, C?sar; Bradley, Patrick B.; Pastor, Nina; Cowan, J. A.; Stemmler, Timothy L. (2007). "Human frataxin: iron and ferrochelatase binding surface". Chemical Communications (18): 1798–1800. doi:10.1039/B703195E. PMC 2862461. PMID 17476391.
  13. ^ James, William D.; Berger, Timothy G. (2006). Andrews' Diseases of the Skin: clinical Dermatology. Saunders Elsevier. ISBN 0-7216-2921-0.
  14. ^ Rüfenacht, U.B.; Gouya, L.; Schneider-Yin, X.; Puy, H.; Schäfer, B.W.; Aquaron, R.; Nordmann, Y.; Minder, E.I.; Deybach, J.C. (1998). "Systematic Analysis of Molecular Defects in the Ferrochelatase Gene from Patients with Erythropoietic Protoporphyria". The American Journal of Human Genetics. 62 (6): 1341–52. doi:10.1086/301870. PMC 1377149. PMID 9585598.
  15. ^ "Lead Toxicity -- What Are Possible Health Effects from Lead Exposure?". Agency for Toxic Substances & Disease Registry. Pristupljeno 9. 2. 2021.
  16. ^ a b Medlock, Amy E.; Shiferaw, Mesafint T.; Marcero, Jason R.; Vashisht, Ajay A.; Wohlschlegel, James A.; Phillips, John D.; Dailey, Harry A.; Liesa, Marc (19. 8. 2015). "Identification of the Mitochondrial Heme Metabolism Complex". PLOS ONE. 10 (8): e0135896. doi:10.1371/journal.pone.0135896. PMC 4545792. PMID 26287972.
  17. ^ a b Chen, W.; Dailey, H. A.; Paw, B. H. (28. 4. 2010). "Ferrochelatase forms an oligomeric complex with mitoferrin-1 and Abcb10 for erythroid heme biosynthesis". Blood. 116 (4): 628–630. doi:10.1182/blood-2009-12-259614. PMC 3324294. PMID 20427704.
  18. ^ Medlock, A.; Swartz, L.; Dailey, T. A.; Dailey, H. A.; Lanzilotta, W. N. (29. 1. 2007). "Substrate interactions with human ferrochelatase". Proceedings of the National Academy of Sciences. 104 (6): 1789–1793. doi:10.1073/pnas.0606144104. PMC 1794275. PMID 17261801.
  19. ^ Medlock, Amy E.; Carter, Michael; Dailey, Tamara A.; Dailey, Harry A.; Lanzilotta, William N. (oktobar 2009). "Product Release Rather than Chelation Determines Metal Specificity for Ferrochelatase". Journal of Molecular Biology. 393 (2): 308–319. doi:10.1016/j.jmb.2009.08.042. PMC 2771925. PMID 19703464.

Dopunska literaturaUredi

  • Cox TM (juni 1997). "Erythropoietic protoporphyria". Journal of Inherited Metabolic Disease. 20 (2): 258–69. doi:10.1023/A:1005317124985. PMID 9211198. S2CID 12493042.
  • Brenner DA, Didier JM, Frasier F, Christensen SR, Evans GA, Dailey HA (juni 1992). "A molecular defect in human protoporphyria". American Journal of Human Genetics. 50 (6): 1203–10. PMC 1682545. PMID 1376018.
  • Nakahashi Y, Fujita H, Taketani S, Ishida N, Kappas A, Sassa S (januar 1992). "The molecular defect of ferrochelatase in a patient with erythropoietic protoporphyria". Proceedings of the National Academy of Sciences of the United States of America. 89 (1): 281–5. doi:10.1073/pnas.89.1.281. PMC 48220. PMID 1729699.
  • Lamoril J, Boulechfar S, de Verneuil H, Grandchamp B, Nordmann Y, Deybach JC (decembar 1991). "Human erythropoietic protoporphyria: two point mutations in the ferrochelatase gene". Biochemical and Biophysical Research Communications. 181 (2): 594–9. doi:10.1016/0006-291X(91)91231-Z. PMID 1755842.
  • Nakahashi Y, Taketani S, Okuda M, Inoue K, Tokunaga R (decembar 1990). "Molecular cloning and sequence analysis of cDNA encoding human ferrochelatase". Biochemical and Biophysical Research Communications. 173 (2): 748–55. doi:10.1016/S0006-291X(05)80099-3. PMID 2260980.
  • Rossi E, Attwood PV, Garcia-Webb P, Costin KA (maj 1990). "Inhibition of human lymphocyte ferrochelatase activity by hemin". Biochimica et Biophysica Acta (BBA) - Protein Structure and Molecular Enzymology. 1038 (3): 375–81. doi:10.1016/0167-4838(90)90251-A. PMID 2340297.
  • Polson RJ, Lim CK, Rolles K, Calne RY, Williams R (septembar 1988). "The effect of liver transplantation in a 13-year-old boy with erythropoietic protoporphyria". Transplantation. 46 (3): 386–9. doi:10.1097/00007890-198809000-00010. PMID 3047929.
  • Bonkovsky HL, Schned AR (januar 1986). "Fatal liver failure in protoporphyria. Synergism between ethanol excess and the genetic defect". Gastroenterology. 90 (1): 191–201. doi:10.1016/0016-5085(86)90093-4. PMID 3940245.
  • Prasad AR, Dailey HA (august 1995). "Effect of cellular location on the function of ferrochelatase". The Journal of Biological Chemistry. 270 (31): 18198–200. doi:10.1074/jbc.270.31.18198. PMID 7629135.
  • Sarkany RP, Alexander GJ, Cox TM (juni 1994). "Recessive inheritance of erythropoietic protoporphyria with liver failure". Lancet. 343 (8910): 1394–6. doi:10.1016/S0140-6736(94)92525-9. PMID 7910885. S2CID 42243172.
  • Tugores A, Magness ST, Brenner DA (decembar 1994). "A single promoter directs both housekeeping and erythroid preferential expression of the human ferrochelatase gene". The Journal of Biological Chemistry. 269 (49): 30789–97. PMID 7983009.
  • Dailey HA, Sellers VM, Dailey TA (januar 1994). "Mammalian ferrochelatase. Expression and characterization of normal and two human protoporphyric ferrochelatases". The Journal of Biological Chemistry. 269 (1): 390–5. PMID 8276824.
  • Wang X, Poh-Fitzpatrick M, Carriero D, Ostasiewicz L, Chen T, Taketani S, Piomelli S (april 1993). "A novel mutation in erythropoietic protoporphyria: an aberrant ferrochelatase mRNA caused by exon skipping during RNA splicing". Biochimica et Biophysica Acta (BBA) - Molecular Basis of Disease. 1181 (2): 198–200. doi:10.1016/0925-4439(93)90112-e. PMID 8481408.
  • Nakahashi Y, Miyazaki H, Kadota Y, Naitoh Y, Inoue K, Yamamoto M, Hayashi N, Taketani S (maj 1993). "Molecular defect in human erythropoietic protoporphyria with fatal liver failure". Human Genetics. 91 (4): 303–6. doi:10.1007/BF00217346. PMID 8500787. S2CID 5844599.
  • Imoto S, Tanizawa Y, Sato Y, Kaku K, Oka Y (juli 1996). "A novel mutation in the ferrochelatase gene associated with erythropoietic protoporphyria". British Journal of Haematology. 94 (1): 191–7. doi:10.1046/j.1365-2141.1996.d01-1771.x. PMID 8757534. S2CID 27290533.
  • Crouse BR, Sellers VM, Finnegan MG, Dailey HA, Johnson MK (decembar 1996). "Site-directed mutagenesis and spectroscopic characterization of human ferrochelatase: identification of residues coordinating the [2Fe-2S] cluster". Biochemistry. 35 (50): 16222–9. doi:10.1021/bi9620114. PMID 8973195.

Vanjski linkoviUredi

Šablon:Enzimi biosinteze porfirina