CHEK2

CHEK2 (kinaza 2 kontrolne tačke) jest gen supresije tumora sa hromosoma 22, koji kod ljudi kodira protein CHK2. Protein je serin-treonin kinaza. CHK2 je uključen u popravak DNK, zaustavljan je ćelijskog ciklusa ili apoptozu, kao odgovor na oštećenje DNK. Mutacije gena CHEK2 povezane su sa širokim spektrom karcinoma.[5]

CHEK2
Protein CHEK2 PDB 1gxc.png
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1GXC, 2CN5, 2CN8, 2W0J, 2W7X, 2WTC, 2WTD, 2XBJ, 2XM8, 2XM9, 2YCF, 2YCQ, 2YCR, 2YCS, 2YIQ, 2YIR, 2YIT, 3I6U, 3I6W, 4A9R, 4A9S, 4A9T, 4A9U, 4BDA, 4BDB, 4BDC, 4BDD, 4BDE, 4BDF, 4BDG, 4BDH, 4BDI, 4BDJ, 4BDK, 2WTI, 2WTJ, 2XK9

Identifikatori
AliasiCHEK2
Vanjski ID-jeviOMIM: 604373 MGI: 1355321 HomoloGene: 38289 GeneCards: CHEK2
Lokacija gena (čovjek)
Hromosom 22 (čovjek)
Hrom.Hromosom 22 (čovjek)[1]
Hromosom 22 (čovjek)
Genomska lokacija za CHEK2
Genomska lokacija za CHEK2
Bend22q12.1Početak28,687,743 bp[1]
Kraj28,742,422 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za CHEK2
Genomska lokacija za CHEK2
Bend5|5 FPočetak110,987,845 bp[2]
Kraj111,022,011 bp[2]
Obrazac RNK ekspresije
PBB GE CHEK2 210416 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija transferase activity
nucleotide binding
protein kinase activity
protein homodimerization activity
metal ion binding
protein serine/threonine kinase activity
GO:0001948, GO:0016582 protein binding
identical protein binding
protein kinase binding
ATP binding
ubiquitin protein ligase binding
kinase activity
Ćelijska komponenta PML body
Golđijev aparat
Nukleoplazma
Telomera
Jedro
citoplazma
Biološki proces positive regulation of protein phosphorylation
GO:0009373 regulation of transcription, DNA-templated
cellular response to bisphenol A
negative regulation of DNA damage checkpoint
Fosforilacija
signal transduction in response to DNA damage
replicative senescence
DNA damage checkpoint signaling
protein stabilization
transcription, DNA-templated
cellular response to DNA damage stimulus
Ćelijska dioba
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
protein phosphorylation
mitotic spindle assembly
G2/M transition of mitotic cell cycle
intrinsic apoptotic signaling pathway in response to DNA damage
DNA damage induced protein phosphorylation
GO:1903362 regulation of protein catabolic process
protein autophosphorylation
Ćelijski ciklus
positive regulation of anoikis
response to gamma radiation
GO:0097285 Apoptoza
double-strand break repair
GO:0100026 Popravka DNK
DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
regulation of signal transduction by p53 class mediator
DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator
GO:0035404 peptidyl-serine phosphorylation
peptidyl-threonine phosphorylation
intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
regulation of apoptotic process
cellular response to gamma radiation
response to glycoside
mitotic DNA damage checkpoint signaling
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001005735
NM_001257387
NM_007194
NM_145862
NM_001349956

NM_016681
NM_001363308

RefSeq (bjelančevina)

NP_001005735
NP_001244316
NP_009125
NP_665861
NP_001336885

NP_057890
NP_001350237

Lokacija (UCSC)Chr 22: 28.69 – 28.74 MbChr 5: 110.99 – 111.02 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Lokacija genaUredi

CHEK2 gen se nalazi na dugom (q) kraku hromosoma 22 na poziciji 12.1. Njegova lokacija na hromosomu 22 proteže se od baznog para 28,687.742 do baznog para 28,741.904.[5]

Aminokiselinska sekvencaUredi

Dužina polipeptidnog lanca je 543 aminokiseline, a molekulska težina 60.915 Da.[6]

1020304050
MSRESDVEAQQSHGSSACSQPHGSVTQSQGSSSQSQGISSSSTSTMPNSS
QSSHSSSGTLSSLETVSTQELYSIPEDQEPEDQEPEEPTPAPWARLWALQ
DGFANLECVNDNYWFGRDKSCEYCFDEPLLKRTDKYRTYSKKHFRIFREV
GPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNKVFV
FFDLTVDDQSVYPKALRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIKI
ISKRKFAIGSAREADPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIV
LELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKP
ENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVG
TAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPE
VWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLS
EENESTALPQVLAQPSTSRKRPREGEAEGAETTKRPAVCAAVL

Struktura proteinaUredi

CHEK2 protein kodiran genom CHEK2 je serin treonin kinaza. Protein se sastoji od 543 aminokiseline i sljedećih domena:

SCD domen sadrži višestruke SQ/TQ motive koji služe kao mjesta fosforilacija, kao odgovor na DNK oštećenje. Najznačajnije i najčešće fosforilirano mjesto je Thr68.[7]

CHK2 se pojavljuje kao monomer u svom neaktivnom stanju. Međutim, u slučaju oštećenja DNK, SCD fosforilacija uzrokuje CHK2 dimerizaciju. Fosforilirani Thr68 (lociran na SCD) stupa u interakciju sa FHA domenom da bi formirao proteinski dimer. Nakon što protein dimerizira, KD se aktivira autofosforilacijom. Jednom kada se KD aktivira, dimer CHK2 se disocira.[7]

Funkcija i mehanizamUredi

Gen CHEK2 kodira kinazu kontrolne tačke 2 (CHK2), protein koji djeluje kao tumorski supresor. CHK2 regulira ćelijsku diobu i ima sposobnost da spriječi prebrzu ili nekontrolisanu podjelu ćelija.[5]

Kada DNK prođe dvolančani prekid, CHK2 se aktivira. Konkretno, protein porodica fosfatidilinozitol-kinaza aktiviran oštećenjem DNK (PIKK) ATM fosforilira mjesto Thr68 i aktivira CHK2.[7] Jednom aktiviran, CHK2 fosforilira nizvodne ciljeve, uključujući CDC25 fosfataze, odgovorne za defosforilaciju i aktiviranje ciklin ovisne kinaze (CDK-a). Dakle, CHK2 inhibicija CDC25 fosfataze sprečava ulazak ćelije u mitozu. Nadalje, CHK2 protein je u interakciji sa nekoliko drugih proteina, uključujući p53. Stabilizacija p53 pomoću CHK2 dovodi do zaustavljanja ćelijskog ciklusa u fazi G1. Nadalje, poznato je da CHK2 fosforilizira transkripcijski faktor ćelijskog ciklusa E2F1 i leukemijski promijelocitni protein (PML) uključen u apoptoze (programiranu ćelijsku smrt).

Povezanost sa rakomUredi

CHK2 protein ima ključnu ulogu u kontrolnoj tački oštećenja DNK. Stoga su mutacije gena CHEK2 označene kao uzroci širokog spektra karcinoma.

Godine 1999. otkriveno je da genetičke varijacije CHEK2 odgovaraju nasljednoj sklonosti ka raku.[8]

Bell et al. (1999) otkrili su tri mutacije zametne linije CHEK2 među četiri slučaja Li–Fraumenijevog sindroma (LFS) i 18 porodica sličnih tom sindromu (LFL). Od vremena ovog otkrića, dvije od tri varijante (delecija u domenu kinaze u egzonu 10 i misens mutacija u FHA domenu u egzona 3) povezane su sa nasljednom osjetljivošću na rak dojke, kao i druge tipove raka.[9]

Osim početnih spekulacija, skrining pacijenata sa LFS i LFL nije otkrio nikakve ili vrlo rijetke individualne misens varijante u CHEK2 genu. Dodatno, delecija u domenu kinaze na egzonu 10 je rijetka među LFS/LFL pacijentima. Dokazi iz ovih studija sugeriraju da CHEK2 nije gen predispozicije za Li-Fraumenijev sindrom.[9]

Rak dojkeUredi

Naslijeđene mutacije u genu CHEK2 povezane su s određenim slučajevima karcinoma dojke. Najvažnije, delecija jednog nukleotida u DNK, na poziciji 1.100 u egzonu 10 (1100delC) proizvodi nefunkcionalnu verziju CHK2 proteina, skraćenu na domen kinaze. Gubitak normalne funkcije proteina CHK2 dovodi do neregulirane diobe ćelija, akumuliranog oštećenja DNK i u mnogim slučajevima razvoja tumora.[5] Mutacija CHEK2*1100del je najčešća kod osoba istočnoevropskog i sjevernoevropskog porekla. Unutar ovih populacija mutacija CHEK2*1100delC viđa se kod 1/100 do 1/200 osoba. Međutim, u Sjevernoj Americi učestalost pada na 1/333 do 1/500. Mutacija je gotovo odsutna u Španiji i Indiji.[10] Studije pokazuju da CHEK2 1100delC odgovara dvostruko povećanom riziku od raka dojke i 10 puta povećanom riziku od raka dojke kod muškaraca.[11]

Mutacija CHEK2 poznata kao I157T varijanta domena FHA u egzonu 3 također je povezana s rakom dojke, ali s manjim rizikom od mutacije CHEK2*1100delC. U SAD-u, procijenjeni udio raka dojke koji se pripisuje ovoj varijanti je oko 1,2%.[9]

Još dvije genske mutacije CHEK2, CHEK2*S428F, aminokiselinska supstitucija u domenu kinaze u egzonu 11 i CHEK2*P85L, supstitucija aminokiselina u N-terminalnoj regiji (egzon 1) pronađene su u populaciji Aškenazi Jevreja.[10] Takođe je opisana sugestija o mutaciji osnivača Hispanskog porekla.[12]

Ostali karcinomiUredi

Mutacije na CHEK2 pronađene su u nasljednim i nenasljednim slučajevima raka. Studije povezuju mutaciju sa slučajevima raka prostate, pluća, debelog crijeva, bubrega i tiroidne žlijezde . Povezane su i sa određenim tumorima mozga i osteosarkomom.[5]

Za razliku od mutacija BRCA1 i BRCA2, čini se da mutacije CHEK2 ne uzrokuju povišeni rizik za karcinom jajnika.[11] Međutim, veliki učinak u asocijacijama u cijelom genomu za pločasti karcinom pluća opisana je za rijetku varijantu u CHEK2 (p.Ile157Thr, rs17879961, OR = 0,38).[13]

MejozaUredi

CHEK2 regulira napredovanje ćelijskog ciklusa i sklapanje vretena tokom sazrevanja mišjih oocita i ranog razvoja embriona.[14][15] Iako je CHEK2 nizvodni efektor ATM-kinaze koja reaguje prvenstveno na dvolančane prekide, može se aktivirati i ATR (ataxia-telangiectasia i Rad3 srodna) kinaza koja reaguje prvenstveno na jednolančane prekide. Kod miševa, CHEK2 je neophodan za nadzor oštećenja DNK u mejozi od ženki. Odgovor oocita na oštećenje dvostrukog lanca DNK uključuje hijerarhiju puteva u kojoj ATR-kinaza signalizira CHEK2, koji zatim aktivira proteine p53 i p63.[16]

Kod voćnih mušica roda Drosophila, zračenje ćelija germ-linije generira dvolančane prekide koji rezultiraju zaustavljanjem ćelijskog ciklusa i apoptozama. Drosophila CHEK2 homolog mnk i p53 ortolog dp53 potrebni su za veći dio ćelijske smrti u ranoj oogenezi kada dođe do selekcije oocita i mejotske rekombinacije.[17]

InterakcijeUredi

Pokazalo se da je CHEK2 u interakciji sa:

ReferenceUredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000183765 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000029521 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b c d e "CHEK2". Genetics Home Reference. August 2007.
  6. ^ "UniProt, O96017" (jezik: engleski). Pristupljeno 04-02-2022. Provjerite vrijednost datuma u parametru: |accessdate= (pomoć)CS1 održavanje: nepreporučeni parametar (link)
  7. ^ a b c Cai Z, Chehab NH, Pavletich NP (September 2009). "Structure and activation mechanism of the CHK2 DNA damage checkpoint kinase". Molecular Cell. 35 (6): 818–29. doi:10.1016/j.molcel.2009.09.007. PMID 19782031.
  8. ^ Bell DW, Varley JM, Szydlo TE, Kang DH, Wahrer DC, Shannon KE, et al. (December 1999). "Heterozygous germ line hCHK2 mutations in Li-Fraumeni syndrome". Science. 286 (5449): 2528–31. doi:10.1126/science.286.5449.2528. PMID 10617473.
  9. ^ a b c Nevanlinna H, Bartek J (September 2006). "The CHEK2 gene and inherited breast cancer susceptibility". Oncogene. 25 (43): 5912–9. doi:10.1038/sj.onc.1209877. PMID 16998506.
  10. ^ a b Offit K, Garber JE (February 2008). "Time to check CHEK2 in families with breast cancer?". Journal of Clinical Oncology. 26 (4): 519–20. doi:10.1200/JCO.2007.13.8503. PMID 18172189.
  11. ^ a b Meijers-Heijboer H, van den Ouweland A, Klijn J, Wasielewski M, de Snoo A, Oldenburg R, et al. (May 2002). "Low-penetrance susceptibility to breast cancer due to CHEK2(*)1100delC in noncarriers of BRCA1 or BRCA2 mutations". Nature Genetics. 31 (1): 55–9. doi:10.1038/ng879. PMID 11967536. S2CID 195216803.
  12. ^ Weitzel JN, Neuhausen SL, Adamson A, Tao S, Ricker C, Maoz A, et al. (August 2019). "Pathogenic and likely pathogenic variants in PALB2, CHEK2, and other known breast cancer susceptibility genes among 1054 BRCA-negative Hispanics with breast cancer". Cancer. 125 (16): 2829–2836. doi:10.1002/cncr.32083. PMC 7376605. PMID 31206626.
  13. ^ Wang Y, McKay JD, Rafnar T, Wang Z, Timofeeva MN, Broderick P, et al. (July 2014). "Rare variants of large effect in BRCA2 and CHEK2 affect risk of lung cancer". Nature Genetics. 46 (7): 736–41. doi:10.1038/ng.3002. PMC 4074058. PMID 24880342.
  14. ^ Dai XX, Duan X, Liu HL, Cui XS, Kim NH, Sun SC (February 2014). "Chk2 regulates cell cycle progression during mouse oocyte maturation and early embryo development". Molecules and Cells. 37 (2): 126–32. doi:10.14348/molcells.2014.2259. PMC 3935625. PMID 24598997.
  15. ^ Ruth KS, Day FR, Hussain J, Martínez-Marchal A, Aiken CE, Azad A, et al. (August 2021). "Genetic insights into biological mechanisms governing human ovarian ageing". Nature. 596 (7872): 393–397. Bibcode:2021Natur.596..393R. doi:10.1038/s41586-021-03779-7. ISSN 0028-0836. PMC 7611832. PMID 34349265 Provjerite vrijednost parametra |pmid= (pomoć).
  16. ^ Bolcun-Filas E, Rinaldi VD, White ME, Schimenti JC (January 2014). "Reversal of female infertility by Chk2 ablation reveals the oocyte DNA damage checkpoint pathway". Science. 343 (6170): 533–6. Bibcode:2014Sci...343..533B. doi:10.1126/science.1247671. PMC 4048839. PMID 24482479.
  17. ^ Shim HJ, Lee EM, Nguyen LD, Shim J, Song YH (2014). "High-dose irradiation induces cell cycle arrest, apoptosis, and developmental defects during Drosophila oogenesis". PLOS ONE. 9 (2): e89009. Bibcode:2014PLoSO...989009S. doi:10.1371/journal.pone.0089009. PMC 3923870. PMID 24551207.
  18. ^ Lee JS, Collins KM, Brown AL, Lee CH, Chung JH (March 2000). "hCds1-mediated phosphorylation of BRCA1 regulates the DNA damage response". Nature. 404 (6774): 201–4. Bibcode:2000Natur.404..201L. doi:10.1038/35004614. PMID 10724175. S2CID 4345911.
  19. ^ Chabalier-Taste C, Racca C, Dozier C, Larminat F (December 2008). "BRCA1 is regulated by Chk2 in response to spindle damage". Biochimica et Biophysica Acta (BBA) - Molecular Cell Research. 1783 (12): 2223–33. doi:10.1016/j.bbamcr.2008.08.006. PMID 18804494.
  20. ^ Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER, Hurov KE, Luo J, et al. (May 2007). "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage". Science. 316 (5828): 1160–6. Bibcode:2007Sci...316.1160M. doi:10.1126/science.1140321. PMID 17525332. S2CID 16648052.
  21. ^ Lou Z, Minter-Dykhouse K, Wu X, Chen J (February 2003). "MDC1 is coupled to activated CHK2 in mammalian DNA damage response pathways". Nature. 421 (6926): 957–61. Bibcode:2003Natur.421..957L. doi:10.1038/nature01447. PMID 12607004. S2CID 4411622.
  22. ^ Adamson AW, Beardsley DI, Kim WJ, Gao Y, Baskaran R, Brown KD (March 2005). "Methylator-induced, mismatch repair-dependent G2 arrest is activated through Chk1 and Chk2". Molecular Biology of the Cell. 16 (3): 1513–26. doi:10.1091/mbc.E04-02-0089. PMC 551512. PMID 15647386.
  23. ^ Brown KD, Rathi A, Kamath R, Beardsley DI, Zhan Q, Mannino JL, Baskaran R (January 2003). "The mismatch repair system is required for S-phase checkpoint activation". Nature Genetics. 33 (1): 80–4. doi:10.1038/ng1052. PMID 12447371. S2CID 20616220.
  24. ^ Chen XB, Melchionna R, Denis CM, Gaillard PH, Blasina A, Van de Weyer I, et al. (November 2001). "Human Mus81-associated endonuclease cleaves Holliday junctions in vitro". Molecular Cell. 8 (5): 1117–27. doi:10.1016/s1097-2765(01)00375-6. PMID 11741546.
  25. ^ Tsvetkov L, Xu X, Li J, Stern DF (March 2003). "Polo-like kinase 1 and Chk2 interact and co-localize to centrosomes and the midbody". The Journal of Biological Chemistry. 278 (10): 8468–75. doi:10.1074/jbc.M211202200. PMID 12493754.
  26. ^ Bahassi EM, Conn CW, Myer DL, Hennigan RF, McGowan CH, Sanchez Y, Stambrook PJ (September 2002). "Mammalian Polo-like kinase 3 (Plk3) is a multifunctional protein involved in stress response pathways". Oncogene. 21 (43): 6633–40. doi:10.1038/sj.onc.1205850. PMID 12242661.

Dopunska literaturaUredi

Vanjski linkoviUredi

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.