Fibronektin je glikoprotein visoke molekulske težine (~500-~600 kDa)[5] u vanćelijskom matriksu koji se vezuje za membranu koji obuhvata receptorske proteine zvane integrin, kod ljudi kodirane genom FN1 sa hromosoma 2.[6] Odobrila ga je Organizacija Central Drugs Standard Control, 2020., kao lokalno rješenje za tržište u Indiji, pod brendom FIBREGA za hronične rane.[7]. Fibronektin se također vezuje za druge proteine vanćedlijskog matriksa kao što su kolagen, fibrin i heparan-sulfatni proteoglikani (npr. sindekani).

FN1
Dostupne strukture
PDBPretraga ortologa: H0Y7Z1%20or%20B7ZLE5 PDBe H0Y7Z1,B7ZLE5 RCSB
Spisak PDB ID kodova

1E88, 1E8B, 1FBR, 1FNA, 1FNF, 1FNH, 1J8K, 1O9A, 1OWW, 1Q38, 1QGB, 1QO6, 1TTF, 1TTG, 2CG6, 2CG7, 2CK2, 2CKU, 2EC3, 2FN2, 2FNB, 2GEE, 2H41, 2H45, 2HA1, 2OCF, 2RKY, 2RKZ, 2RL0, 3CAL, 3EJH, 3GXE, 3M7P, 3MQL, 3R8Q, 3ZRZ, 4GH7, 4JE4, 4JEG, 4LXO, 4MMX, 4MMY, 4MMZ, 4PZ5, 2N1K, 5DC4, 5DC0, 5DC9, 3T1W

Identifikatori
AliasiFN1
Vanjski ID-jeviOMIM: 135600 MGI: 95566 HomoloGene: 1533 GeneCards: FN1
Lokacija gena (čovjek)
Hromosom 2 (čovjek)
Hrom.Hromosom 2 (čovjek)[1]
Hromosom 2 (čovjek)
Genomska lokacija za FN1
Genomska lokacija za FN1
Bend2q35Početak215,360,440 bp[1]
Kraj215,436,073 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za FN1
Genomska lokacija za FN1
Bend1 C3|1 36.05 cMPočetak71,624,679 bp[2]
Kraj71,692,359 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija heparin binding
collagen binding
integrin binding
GO:0001948, GO:0016582 protein binding
identical protein binding
peptidase activator activity
protease binding
Ćelijska komponenta blood microparticle
GO:0005578 Vanćelijski matriks
Fibrinogen
extracellular region
basement membrane
apical plasma membrane
Egzosom
platelet alpha granule lumen
endoplasmic reticulum-Golgi intermediate compartment
Vanćelijska tečnost
Biološki proces regulation of protein phosphorylation
calcium-independent cell-matrix adhesion
endodermal cell differentiation
positive regulation of fibroblast proliferation
positive regulation of substrate-dependent cell migration, cell attachment to substrate
platelet degranulation
extracellular matrix disassembly
Zarastanje rana
positive regulation of peptidase activity
GO:0051357, GO:0051358, GO:0051359 peptide cross-linking
Ćelijska adhezija
GO:1901313 positive regulation of gene expression
acute-phase response
Angiogeneza
positive regulation of cell population proliferation
regulation of cell shape
regulation of ERK1 and ERK2 cascade
cell-substrate junction assembly
substrate adhesion-dependent cell spreading
integrin activation
positive regulation of axon extension
cell-matrix adhesion
leukocyte migration
response to wounding
extracellular matrix organization
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_001306129
NM_001306130
NM_001306131
NM_001306132
NM_002026

NM_054034
NM_212474
NM_212475
NM_212476
NM_212478
NM_212482
NM_001365517
NM_001365518
NM_001365519
NM_001365520
NM_001365521
NM_001365522
NM_001365523
NM_001365524

NM_001276408
NM_001276409
NM_001276410
NM_001276411
NM_001276412

NM_001276413
NM_010233

RefSeq (bjelančevina)
NP_001293058
NP_001293059
NP_001293060
NP_001293061
NP_002017

NP_473375
NP_997639
NP_997641
NP_997643
NP_997647
NP_001352446
NP_001352447
NP_001352448
NP_001352449
NP_001352450
NP_001352451
NP_001352452
NP_001352453
NP_001293058.1
NP_001293059.1
NP_001293061.1

NP_001263337
NP_001263338
NP_001263339
NP_001263340
NP_001263341

NP_001263342
NP_034363

Lokacija (UCSC)Chr 2: 215.36 – 215.44 MbChr 1: 71.62 – 71.69 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Modularna struktura fibronektina i njegovi vezujući domeni

Fibronektin postoji kao proteinski dimer, koji se sastoji od dva skoro identična monomera povezana parom disulfidnih veza.[6] Protein fibronektina se proizvodi iz jednog gena, ali alternativna prerada njegove pre-iRNK dovodi do stvaranja nekoliko izoformi.

Kičmenjaci imaju dva tipa fibronektina:[6]

  • rastvorljivi fibronektin u plazmi (ranije nazvan "hladno-netopivi globulin" ili CIg) je glavna proteinska komponenta krvne plazme (300 μg/ml) i proizvodi se u jetri pomoću hepatocita.
  • nerastvorljivi ćelijski fibronektin je glavna komponenta vanćelijskog matriksa. Izlučuju ga različite ćelije, prvenstveno fibroblasti, kao rastvorljivi dimeeri, a zatim se sklapa u nerastvorljivi matriks u složenom procesu posredovanom ćelijama.

Fibronektin ima glavnu ulogu u ćelijskoj adheziji, rastu, migracijama i diferencijaciji, a važan je za procese kao što su zacjeljivanje rana i embrionalni razvoj.[6] Promijenjeni fibronektin eksprimira se kao, degradacija i izmijenjena organizacija i povezani su s brojnim od patološkim stanjima, uključujući rak, artritis i fibrozu.[8][9]

Aminokiselinska sekvenca uredi

Dužina polipeptidnog lanca je 2.386 aminokiselina, a molekulska težina 262.625 Da.[6]

1020304050
MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKP
GCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDK
YTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKI
GDTWRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGET
WEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKD
NRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQT
YGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSF
CTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQ
NYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVG
NGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGR
GRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNS
VGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTT
STSTPVTSNTVTGETTPFSPLVATSESVTEITASSFVVSWVSASDTVSGF
RVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQS
LILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVE
GSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEH
GQRLPISRNTFAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAP
TNLQFVNETDSTVLVRWTPPRAQITGYRLTVGLTRRGQPRQYNVGPSVSK
YPLRNLQPASEYTVSLVAIKGNQESPKATGVFTTLQPGSSIPPYNTEVTE
TTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYV
YTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTV
KDDKESVPISDTIIPAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLV
RYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPL
RGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGR
PREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDV
PRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSK
STATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQV
TDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIE
GLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKI
AWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTV
SVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLT
GYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLT
SRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVP
ANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDAS
TAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPR
PRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTL
PHPNLHGPEILDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQM
IFEEHGFRRTTPPTTATPIRHRPRPYPPNVGEEIQIGHIPREDVDYHLYP
HGPGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRV
PGTSTSATLTGLTRGATYNVIVEALKDQQRHKVREEVVTVGNSVNEGLNQ
PTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRW
CHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGK
TYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSY
NQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE

Struktura uredi

Fibronektin postoji kao proteinski dimer, koji se sastoji od dva skoro identična polipeptidna lanca povezana parom C-terminalnih disulfidnih veza.[10] Svaki fibronektinska podjedinica ima molekulsku težinu od ~230–~275 kDa[11] i sadrži tri tipa modula: tip I, II i III. Sva tri modula su sastavljena od po dva antiparalelna β-lista što rezultira beta-sendvičem; međutim, tip I i tip II su stabilizovani unutarlančanim disulfidnim vezama, dok moduli tip III ne sadrže bilo koje disulfidne veze. Odsustvo disulfidnih veza u modulima tipa III omogućava im da se djelimično odmotaju pod primijenjenom silom.[12]

Tri regiona varijabilne prerade RNK javljaju se duž fibronektinakog protomera. Jedan ili oba "ekstra" modula tipa III (EIIIA i EIIIB) mogu biti prisutni u ćelijskom fibronektinu, ali nikada nisu prisutni u fibronektinu u plazmi. "Varijabilna" V-regija postoji između III14–15 (14. i 15. tip III modul). Struktura V-regije se razlikuje od modula tipa I, II i III, a njeno prisustvo i dužina mogu varirati. V-regija sadrži mjesto vezanja za α4β1 integrine. Prisutan je u većini ćelijskog fibronektina, ali samo jedna od dvije podjedinice u dimeru fibronektina u plazmi sadrži sekvencu V-regije.

Moduli su raspoređeni u nekoliko funkcionalnih i protein-vezujućih domena duž dužine fibronektinskih monomera. Postoje četiri domena koje vežu fibronektin, omogućavajući fibronektinu da se poveže sa drugim molekulama fibronektina.[10] Jedan od ovih domena koji vežu fibronektin, I1–5, se naziva "domen sastavljanja", a potreban je za iniciranje sklapanja fibronektinskog matriksa. Moduli III9–10 odgovaraju "domenu koji se vezuje za ćelije" fibronektina. RGD sekvenca (Arg–Gly–Asp) nalazi se u III10 i mjesto je ćelijska vezanost preko α5β1 i αVβ3 integrina na površini ćelije. "Sinergijsko mjesto" nalazi se u III9 i ima ulogu u moduliranju povezanosti fibronektina sa α5β1 integrinima.[13] Fibronektin također sadrži domene za fibrinsko vezivanje (I1–5, I10–12), kolagensko-vezivanje (I 6–9), fibulin-1-vezivanje (III13–14), heparin-vezivanje i sindekan-vezivanje (III< sub>12–14).[10]

Funkcija uredi

Fibronektin ima brojne funkcije koje osiguravaju normalno funkcioniranje kičmenjačkih organizama.[6] Uključen je u ćelijsku adheziju, rast, migracija i diferencijacijU. Ćelijski fibronektin se sklapa u vanćelijskiom matriksu u netopivu mrežu koja razdvaja i podržava organe i tkiva organizma.

Fibronektin ima ključnu ulogu u zacjeljivanju rana.[14][15] Zajedno s fibrinom i plazmom fibronektin se taloži na mjestu ozljede, formirajući krvni ugrušak koji zaustavlja krvarenje i štiti osnovno tkivo. Kako se obnavljanje ozlijeđenog tkiva nastavlja, fibroblasti i makrofagi počinju remodelirati područje, razgrađujući proteine koji formiraju privremeni matriks krvnog ugruška i zamjenjujući ih matriksom koje više liči na normalno, okolno tkivo. Fibroblasti luče proteaze, uključujući matriksne metaloproteinaze, koje probavljaju fibronektin plazme, a zatim fibroblasti luče ćelijski fibronektin i sastavljaju ga u nerastvorljiv matriks. Predloženo je da fragmentacija fibronektina proteazama potiče kontrakciju rane, što je kritičan korak u zacijeljenju rana. Fragmentiranje fibronektina dalje otkriva njegovu V-regiju, koja sadrži mjesto za α4β1 integrinsko vezivanje. Vjeruje se da ovi fragmenti fibronektina poboljšavaju vezivanje ćelija koje eksprimiraju α4β1 integrin, omogućavajući im da se prianjaju i snažno kontrahiraju okolni matriks.

Fibronektin je neophodan za embriogenezu, a inaktiviranje gena za fibronektin rezultira ranom smrtnošću embriona.[16] Fibronektin je važan za vođenje vezivanje ćelija i migracija tokom embrionskog razvoja. U razvoju sisara, odsustvo fibronektina dovodi do defekta u mezodermnom i vaskularnom razvoju nervne cijevi. Slično tome, odsustvo normalnog fibronektinskog matriksa u razvoju vodozemaca uzrokuje defekte mezodermnog obrasca i inhibira gastrulaciju.[17]

Fibronektin se također nalazi u normalnoj ljudskoj pljuvački, što pomaže u sprječavanju kolonizacije usne šupljine i ždrijela od strane patogenih bakterija.[18]

Klinički značaj uredi

Uloga u kanceru uredi

Nekoliko morfoloških promjena je primijećeno u tumorima i tumorskim ćelijskim linijama koje se pripisuju smanjenom fibronektinu ekspresija, povećanom fibronektinu degradacija i /ili smanjena ekspresija fibronektin-vezujućih receptora, kao što je α5β1 integrini.[19]

Fibronektin je uključen u razvoj karcinoma.[20] Kod karcinoma pluća, fibronektin ekspresija je povećan posebno kod karcinoma pluća nemalih ćelija. Adhezija ćelija karcinoma pluća na fibronektin povećava tumorigenost i daje otpornost na apoptoza-inducirajuće hemoterapeutske agense. Pokazalo se da fibronektin stimuliše gonadne steroide koji stupaju u interakciju sa kičmenjačkim androgenim receptorima, koji su sposobni kontrolirati ekspresije ciklina D i srodnih gena uključenih u kontrolu ćelijskog ciklusa. Ova zapažanja sugeriraju da fibronektin može promovirati rast tumora/preživljavanje i otpornost na terapiju, i mogao bi predstavljati novu metu za razvoj novih lijekova protiv raka.

Fibronektin 1 djeluje kao potencijal biomarker za radiorezistenciju[21] i za karcersku prognozu.[22]

Fuzija FN1-FGFR1 je česta kod fosfaturnih mezenhimnih tumora.[23][24]

Uloga u zacjeljivanju rana uredi

Fibronektin ima duboke efekte na zacjeljivanje rana, uključujući formiranje odgovarajućeg supstrata za migraciju i rast ćelija tokom razvoja i organizacije granulacijskog tkiva, kao i remodeliranje i resintezu matriksa vezivnog tkiva.[25] Biološki značaj fibronektina in vivo proučavan je tokom mehanizma zacjeljivanja rana.[25] Nivo fibronektina u plazmi je smanjen kod akutne upale ili nakon hirurške traume i kod pacijenata sa diseminiranom intravaskularnom koagulacijom.[26]

Fibronektin se nalazi u vanćelijskom matriksu embrionskih i odraslih tkiva (ne u baznoj membrani tkiva odraslih), ali može biti šire rasprostranjen u upalnim lezijama. Tokom zgrušavanja krvi, fibronektin ostaje povezan sa ugruškom, kovalentno umrežen sa fibrinom uz pomoć faktora VIII (fibrin-stabilizujući faktor).[27][28] Fibroblasti imaju glavnu ulogu u zacjeljivanju rana tako što se drže fibrina. Adhezija fibroblasta na fibrin zahtijeva fibronektin, a bila je najjača kada je fibronektin bio unakrsno vezan za fibrin. Pacijenti sa nedostatkom Faktora XIII pokazuju smetnje u zacjeljivanju rana jer fibroblasti ne rastu dobro u fibrinu kojem nedostaje Faktor XIII. Fibronektin potdstiče čestice fagocitoze i makrofaga i fibroblasta. Taloženje kolagena na mjestu rane, fibroblastima se odvija uz pomoć fibronektina. Takođe je primijećeno da je fibronektin blisko povezan sa novotaloženim kolagenskim fibrilima. Na osnovu veličine i histoloških karakteristika bojenja fibrila, vjerovatno je da se barem dijelom sastoje od kolagena tipa III (retikulin). " Studija in vitro" sa prirodnim kolagenom pokazala je da se fibronektin veže za kolagen tipa III, a ne za njegove druge tipove.[29]

Interakcije uredi

Osim integrina, fibronektin se vezuje za mnoge druge molekule domaćina i nedomaćine. Naprimjer, pokazalo se da djeluje s proteinima kao što su fibrin, tenascin, TNF-α, BMP-1, rotavirus NSP-4 i mnogim proteinima koji se vezuju za fibronektin iz bakterija (kao što je FBP-A ; FBP-B na N-terminalnom domenu), kao i glikozaminoglikan, heparan-sulfat.

Pokazalo se da fibronektin reaguje sa:

Također pogledajte uredi

Reference uredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000115414 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000026193 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Mitrović, S.; Mitrović, D.; Todorović, V. (juli 1995). "[Fibronectin--a multifunctional glycoprotein]". Srpski Arhiv Za Celokupno Lekarstvo. 123 (7–8): 198–201. ISSN 0370-8179. PMID 17974429. Arhivirano s originala, 9. 2. 2022.
  6. ^ a b c d e f Pankov R, Yamada KM (Oct 2002). "Fibronectin at a glance". Journal of Cell Science. 115 (Pt 20): 3861–3. doi:10.1242/jcs.00059. PMID 12244123.
  7. ^ "FIBREGA". www.fibrega.com. Pristupljeno 31. 3. 2023.
  8. ^ Williams CM, Engler AJ, Slone RD, Galante LL, Schwarzbauer JE (maj 2008). "Fibronectin expression modulates mammary epithelial cell proliferation during acinar differentiation". Cancer Research. 68 (9): 3185–92. doi:10.1158/0008-5472.CAN-07-2673. PMC 2748963. PMID 18451144.
  9. ^ Kragstrup, T. W.; Sohn, D. H.; Lepus, C. M.; Onuma, K.; Wang, Q.; Robinson, W. H.; Sokolove, J. (2019). "Fibroblast-like synovial cell production of extra domain A fibronectin associates with inflammation in osteoarthritis". BMC Rheumatology. 3: 46. doi:10.1186/s41927-019-0093-4. PMC 6886182. PMID 31819923.
  10. ^ a b c Mao Y, Schwarzbauer JE (Sep 2005). "Fibronectin fibrillogenesis, a cell-mediated matrix assembly process". Matrix Biology. 24 (6): 389–99. doi:10.1016/j.matbio.2005.06.008. PMID 16061370.
  11. ^ Sitterley, G. "Fibronectin". Sigma Aldrich.
  12. ^ Erickson HP (2002). "Stretching fibronectin". Journal of Muscle Research and Cell Motility. 23 (5–6): 575–80. doi:10.1023/A:1023427026818. PMID 12785106. S2CID 7052723.
  13. ^ Sechler JL, Corbett SA, Schwarzbauer JE (Dec 1997). "Modulatory roles for integrin activation and the synergy site of fibronectin during matrix assembly". Molecular Biology of the Cell. 8 (12): 2563–73. doi:10.1091/mbc.8.12.2563. PMC 25728. PMID 9398676.
  14. ^ Grinnell F (1984). "Fibronectin and wound healing". Journal of Cellular Biochemistry. 26 (2): 107–116. doi:10.1002/jcb.240260206. PMID 6084665. S2CID 28645109.
  15. ^ Valenick LV, Hsia HC, Schwarzbauer JE (Sep 2005). "Fibronectin fragmentation promotes alpha4beta1 integrin-mediated contraction of a fibrin-fibronectin provisional matrix". Experimental Cell Research. 309 (1): 48–55. doi:10.1016/j.yexcr.2005.05.024. PMID 15992798.
  16. ^ George EL, Georges-Labouesse EN, Patel-King RS, Rayburn H, Hynes RO (Dec 1993). "Defects in mesoderm, neural tube and vascular development in mouse embryos lacking fibronectin". Development. 119 (4): 1079–91. doi:10.1242/dev.119.4.1079. PMID 8306876.
  17. ^ Darribère T, Schwarzbauer JE (Apr 2000). "Fibronectin matrix composition and organization can regulate cell migration during amphibian development". Mechanisms of Development. 92 (2): 239–50. doi:10.1016/S0925-4773(00)00245-8. PMID 10727862. S2CID 2640979.
  18. ^ Hasty DL, Simpson WA (Sep 1987). "Effects of fibronectin and other salivary macromolecules on the adherence of Escherichia coli to buccal epithelial cells". Infection and Immunity. 55 (9): 2103–9. doi:10.1128/IAI.55.9.2103-2109.1987. PMC 260663. PMID 3305363.
  19. ^ Hynes, Richard O. (1990). Fibronectins. Berlin: Springer-Verlag. ISBN 978-0-387-97050-9.
  20. ^ Han S, Khuri FR, Roman J (Jan 2006). "Fibronectin stimulates non-small cell lung carcinoma cell growth through activation of Akt/mammalian target of rapamycin/S6 kinase and inactivation of LKB1/AMP-activated protein kinase signal pathways". Cancer Research. 66 (1): 315–23. doi:10.1158/0008-5472.CAN-05-2367. PMID 16397245.
  21. ^ Jerhammar F, Ceder R, Garvin S, Grénman R, Grafström RC, Roberg K (Dec 2010). "Fibronectin 1 is a potential biomarker for radioresistance in head and neck squamous cell carcinoma". Cancer Biology & Therapy. 10 (12): 1244–1251. doi:10.4161/cbt.10.12.13432. PMID 20930522.
  22. ^ Chicco, Davide; Alameer, Abbas; Rahmati, Sara; Jurman, Giuseppe (3. 11. 2022). "Towards a potential pan-cancer prognostic signature for gene expression based on probesets and ensemble machine learning". BioData Mining. 15 (1): 28. doi:10.1186/s13040-022-00312-y. eISSN 1756-0381. PMC 9632055 Provjerite vrijednost parametra |pmc= (pomoć). PMID 36329531 Provjerite vrijednost parametra |pmid= (pomoć).
  23. ^ Wasserman JK, Purgina B, Lai CK, Gravel D, Mahaffey A, Bell D, Chiosea SI (Jan 2016). "Phosphaturic Mesenchymal Tumor Involving the Head and Neck: A Report of Five Cases with FGFR1 Fluorescence In Situ Hybridization Analysis". Head and Neck Pathology. 10 (3): 279–85. doi:10.1007/s12105-015-0678-1. PMC 4972751. PMID 26759148.
  24. ^ Lee JC, Jeng YM, Su SY, Wu CT, Tsai KS, Lee CH, Lin CY, Carter JM, Huang JW, Chen SH, Shih SR, Mariño-Enríquez A, Chen CC, Folpe AL, Chang YL, Liang CW (Mar 2015). "Identification of a novel FN1-FGFR1 genetic fusion as a frequent event in phosphaturic mesenchymal tumour". The Journal of Pathology. 235 (4): 539–45. doi:10.1002/path.4465. PMID 25319834. S2CID 9887919.
  25. ^ a b Grinnell F, Billingham RE, Burgess L (Mar 1981). "Distribution of fibronectin during wound healing in vivo". The Journal of Investigative Dermatology. 76 (3): 181–189. doi:10.1111/1523-1747.ep12525694. PMID 7240787.
  26. ^ Bruhn HD, Heimburger N (1976). "Factor-VIII-related antigen and cold-insoluble globulin in leukemias and carcinomas". Haemostasis. 5 (3): 189–192. doi:10.1159/000214134. PMID 1002003.
  27. ^ Mosher DF (Aug 1975). "Cross-linking of cold-insoluble globulin by fibrin-stabilizing factor". The Journal of Biological Chemistry. 250 (16): 6614–6621. doi:10.1016/S0021-9258(19)41110-1. PMID 1158872.
  28. ^ Mosher DF (Mar 1976). "Action of fibrin-stabilizing factor on cold-insoluble globulin and alpha2-macroglobulin in clotting plasma". The Journal of Biological Chemistry. 251 (6): 1639–1645. doi:10.1016/S0021-9258(17)33696-7. PMID 56335.
  29. ^ Engvall E, Ruoslahti E, Miller EJ (Jun 1978). "Affinity of fibronectin to collagens of different genetic types and to fibrinogen". The Journal of Experimental Medicine. 147 (6): 1584–1595. doi:10.1084/jem.147.6.1584. PMC 2184308. PMID 567240.
  30. ^ Jalkanen S, Jalkanen M (Feb 1992). "Lymphocyte CD44 binds the COOH-terminal heparin-binding domain of fibronectin". The Journal of Cell Biology. 116 (3): 817–25. doi:10.1083/jcb.116.3.817. PMC 2289325. PMID 1730778.
  31. ^ Lapiere JC, Chen JD, Iwasaki T, Hu L, Uitto J, Woodley DT (Nov 1994). "Type VII collagen specifically binds fibronectin via a unique subdomain within the collagenous triple helix". The Journal of Investigative Dermatology. 103 (5): 637–41. doi:10.1111/1523-1747.ep12398270. PMID 7963647.
  32. ^ Chen M, Marinkovich MP, Veis A, Cai X, Rao CN, O'Toole EA, Woodley DT (Jun 1997). "Interactions of the amino-terminal noncollagenous (NC1) domain of type VII collagen with extracellular matrix components. A potential role in epidermal-dermal adherence in human skin". The Journal of Biological Chemistry. 272 (23): 14516–22. doi:10.1074/jbc.272.23.14516. PMID 9169408.
  33. ^ Salonen EM, Jauhiainen M, Zardi L, Vaheri A, Ehnholm C (Dec 1989). "Lipoprotein(a) binds to fibronectin and has serine proteinase activity capable of cleaving it". The EMBO Journal. 8 (13): 4035–40. doi:10.1002/j.1460-2075.1989.tb08586.x. PMC 401578. PMID 2531657.
  34. ^ Martin JA, Miller BA, Scherb MB, Lembke LA, Buckwalter JA (Jul 2002). "Co-localization of insulin-like growth factor binding protein 3 and fibronectin in human articular cartilage". Osteoarthritis and Cartilage. 10 (7): 556–63. doi:10.1053/joca.2002.0791. PMID 12127836.
  35. ^ Gui Y, Murphy LJ (maj 2001). "Insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) binds to fibronectin (FN): demonstration of IGF-I/IGFBP-3/fn ternary complexes in human plasma". The Journal of Clinical Endocrinology and Metabolism. 86 (5): 2104–10. doi:10.1210/jcem.86.5.7472. PMID 11344214.
  36. ^ Chung CY, Zardi L, Erickson HP (Dec 1995). "Binding of tenascin-C to soluble fibronectin and matrix fibrils". The Journal of Biological Chemistry. 270 (48): 29012–7. doi:10.1074/jbc.270.48.29012. PMID 7499434.
  37. ^ Zhou Y, Li L, Liu Q, Xing G, Kuai X, Sun J, Yin X, Wang J, Zhang L, He F (maj 2008). "E3 ubiquitin ligase SIAH1 mediates ubiquitination and degradation of TRB3". Cellular Signalling. 20 (5): 942–8. doi:10.1016/j.cellsig.2008.01.010. PMID 18276110.

Dopunska literatura uredi

Vanjski linkovi uredi

Šablon:Globulini