Oksitocinski receptor, znan i kao OXTR, jest protein koji je kod ljudi kodiran genom OXTR sa hromosoma 3. Funkcionira kao receptor za hormone i neurotransmiter oksitocin.[4][5][6][7][8]

OXTR
Identifikatori
AliasiOXTR
Vanjski ID-jeviOMIM: 167055 MGI: 109147 HomoloGene: 20255 GeneCards: OXTR
Lokacija gena (miš)
Hromosom 6 (miš)
Hrom.Hromosom 6 (miš)[1]
Hromosom 6 (miš)
Genomska lokacija za OXTR
Genomska lokacija za OXTR
Bend6|6 E3Početak112,450,644 bp[1]
Kraj112,466,904 bp[1]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija G protein-coupled receptor activity
peptide binding
signal transducer activity
peptide hormone binding
vasopressin receptor activity
oxytocin receptor activity
Ćelijska komponenta integral component of membrane
membrana
ćelijska membrana
integral component of plasma membrane
intracellular anatomical structure
microvillus
apical plasma membrane
Biološki proces response to cocaine
positive regulation of synapse assembly
positive regulation of norepinephrine secretion
response to cytokine
maternal process involved in parturition
response to estradiol
Mišićna kontrakcija
response to anoxia
GO:1904578 response to organic cyclic compound
eating behavior
ejakulacija
estrous cycle
positive regulation of cytosolic calcium ion concentration
response to progesterone
response to amphetamine
ERK1 and ERK2 cascade
regulation of systemic arterial blood pressure by vasopressin
response to steroid hormone
response to peptide hormone
negative regulation of gastric acid secretion
Memorija
positive regulation of synaptic transmission, GABAergic
response to peptide
heart development
cell surface receptor signaling pathway
telencephalon development
Spavanje
cellular response to hormone stimulus
positive regulation of blood pressure
positive regulation of synaptic transmission, glutamatergic
maternal behavior
positive regulation of vasoconstriction
socijalno ponašanje
positive regulation of penile erection
lactation
digestive tract development
regulation of digestive system process
GO:0072468 Transdukcija signala
positive regulation of uterine smooth muscle contraction
suckling behavior
female pregnancy
G protein-coupled receptor signaling pathway
positive regulation of cold-induced thermogenesis
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_000916

NM_001081147

RefSeq (bjelančevina)

NP_000907
NP_001341582
NP_001341583
NP_001341584
NP_001341585

NP_001074616

Lokacija (UCSC)n/aChr 6: 112.45 – 112.47 Mb
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš
Filogenetsko stablo oksitocinskih, vazotocinskih, mezotocinskih i izotocinskih receptora i nihovih liganada. Prema Koechbach et al.[9]

Aminokiselinska sekvenca

uredi

Dužina polipeptidnog lanca je 389 aminokiselina, а molekulska težina 42.772 Da.[10]

1020304050
MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLIL
LLALSGNACVLLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWD
ITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLAICQPLRSLRR
RTDRLAVLATWLGCLVASAPQVHIFSLREVADGVFDCWAVFIQPWGPKAY
ITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAAAEAPEGAAAG
DGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSAS
YLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA

Funkcija i lokacija

uredi

OXTR protein pripada porodici G-protein spregnutih receptora, konkretno Gq,[4] i djeluje kao receptor za oksitocin. Njegovu aktivnost posreduje G-protein koji aktivira nekoliko različitih sistema drugog glasnika.[11][12]

Oksitocinski receptori se eksprimiraju u mioepitelnim ćelijama mliječnim žlijezdama, i u miometriju i endometriju maternice na kraju trudnoća. Sistem receptora oksitocin-oksitocin ima važnu ulogu kao induktor kontrakcija maternice tokom porođaja i izbacivanja mlijeka.

OXTR je također povezan sa centralnim nervnim sistemom. Vjeruje se da gen ima glavnu ulogu u društvenom, kognitivnom i emocijskom ponašanju.[13] Vjeruje se da je povećanje ekspresije ovog gena povezano s neemocijskim osobinama, grubim razmišljanjem i problemima s prepoznavanjem lica i emocija. Također se vjeruje i da smanjenje ekspresije ovog gena dovodi do prenatalnog stresa, postnatalne depresije i socijalne anksioznosti.[13] Moraju se obaviti dalja istraživanja prije zaključivanja ovih nalaza,ali jaki dokazi upućuju u tom smjeru . OXTR je također u snažnoj korelaciji s amigdalom i odgovorima povezanim sa strahom. Studije sugeriraju da metilacija OXTR-a, koja smanjuje regulaciju oksitocinskih mehanizama, rezultira povećanjem sive tvari u amigdali, što se dalje povezuje sa smanjenjem parasimpatičkog tonusa.[14]

Kod nekih sisara, oksitocinski receptori se također nalaze u bubrezima i srcu.

Reference

uredi
  1. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000049112 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ a b Gimpl G, Fahrenholz F (april 2001). "The oxytocin receptor system: structure, function, and regulation". Physiological Reviews. 81 (2): 629–83. doi:10.1152/physrev.2001.81.2.629. PMID 11274341. S2CID 13265083.
  5. ^ Zingg HH, Laporte SA (juli 2003). "The oxytocin receptor". Trends in Endocrinology and Metabolism. 14 (5): 222–7. doi:10.1016/S1043-2760(03)00080-8. PMID 12826328. S2CID 21540056.
  6. ^ EntrezGene 5021
  7. ^ Kimura T, Tanizawa O, Mori K, Brownstein MJ, Okayama H (april 1992). "Structure and expression of a human oxytocin receptor" (PDF). Nature. 356 (6369): 526–9. Bibcode:1992Natur.356..526K. doi:10.1038/356526a0. PMID 1313946. S2CID 4273722. Arhivirano s originala (PDF), 21. 9. 2017. Pristupljeno 4. 11. 2021.
  8. ^ Simmons CF, Clancy TE, Quan R, Knoll JH (april 1995). "The oxytocin receptor gene (OXTR) localizes to human chromosome 3p25 by fluorescence in situ hybridization and PCR analysis of somatic cell hybrids". Genomics. 26 (3): 623–5. doi:10.1016/0888-7543(95)80188-R. PMID 7607693.
  9. ^ Koehbach J, Stockner T, Bergmayr C, Muttenthaler M, Gruber CW (februar 2013). "Insights into the molecular evolution of oxytocin receptor ligand binding". Biochemical Society Transactions. 41 (1): 197–204. doi:10.1042/BST20120256. PMC 3634130. PMID 23356283.
  10. ^ "UniProt, P30559" (jezik: engleski). Pristupljeno 4. 11. 2021.
  11. ^ Devost D, Wrzal P, Zingg HH (2008). "Oxytocin receptor signalling". Advances in Vasopressin and Oxytocin — from Genes to Behaviour to Disease. Progress in Brain Research. 170. str. 167–76. doi:10.1016/S0079-6123(08)00415-9. ISBN 978-0-444-53201-5. PMID 18655881.
  12. ^ Gimpl G, Reitz J, Brauer S, Trossen C (2008). "Oxytocin receptors: ligand binding, signalling and cholesterol dependence". Advances in Vasopressin and Oxytocin — from Genes to Behaviour to Disease. Progress in Brain Research. 170. str. 193–204. doi:10.1016/S0079-6123(08)00417-2. ISBN 978-0-444-53201-5. PMID 18655883.
  13. ^ a b Maud C, Ryan J, McIntosh JE, Olsson CA (maj 2018). "The role of oxytocin receptor gene (OXTR) DNA methylation (DNAm) in human social and emotional functioning: a systematic narrative review". BMC Psychiatry. 18 (1): 154. doi:10.1186/s12888-018-1740-9. PMC 5975530. PMID 29843655.
  14. ^ Lancaster K, Goldbeck L, Puglia MH, Morris JP, Connelly JJ (novembar 2018). "DNA methylation of OXTR is associated with parasympathetic nervous system activity and amygdala morphology". Social Cognitive and Affective Neuroscience. 13 (11): 1155–1162. doi:10.1093/scan/nsy086. PMC 6234329. PMID 30257007.

Vanjski linkovi

uredi

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.


Šablon:Neuropeptidni receptori Šablon:Modulatori oksitocinskih i vazopresinskih receptora