LYPLA3

(Preusmjereno sa Fosfolipaza)

Fosfolipaza A2 grupe XV je enzim koji je kod ljudi kodiran genom PLA2G15.[5][6][7]

LYPLA3
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4X90, 4X91, 4X92, 4X93, 4X94, 4X95, 4X97

Identifikatori
AliasiPLA2G15
Vanjski ID-jeviOMIM: 609362 MGI: 2178076 HomoloGene: 8200 GeneCards: PLA2G15
Lokacija gena (čovjek)
Hromosom 16 (čovjek)
Hrom.Hromosom 16 (čovjek)[1]
Hromosom 16 (čovjek)
Genomska lokacija za LYPLA3
Genomska lokacija za LYPLA3
Bend16q22.1Početak68,245,304 bp[1]
Kraj68,261,058 bp[1]
Lokacija gena (miš)
Hromosom 8 (miš)
Hrom.Hromosom 8 (miš)[2]
Hromosom 8 (miš)
Genomska lokacija za LYPLA3
Genomska lokacija za LYPLA3
Bend8|8 D3Početak106,877,031 bp[2]
Kraj106,891,347 bp[2]
Obrazac RNK ekspresije
PBB GE LYPLA3 204458 at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija transferase activity
O-acyltransferase activity
lysophospholipase activity
acyltransferase activity
hydrolase activity
phospholipid binding
calcium-independent phospholipase A2 activity
Ćelijska komponenta membrana
mitohondrija
Lizozom
Egzosom
Vanćelijsko
Nukleoplazma
intracellular membrane-bounded organelle
extracellular region
Biološki proces fatty acid catabolic process
phosphatidylcholine catabolic process
ceramide metabolic process
lipid metabolism
fatty acid metabolic process
lipid catabolic process
phosphatidylethanolamine catabolic process
glycerophospholipid metabolic process
phosphatidylcholine metabolic process
phospholipid metabolic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_012320
NM_001363551

NM_133792
NM_001357319

RefSeq (bjelančevina)

NP_036452
NP_001350480

NP_598553
NP_001344248

Lokacija (UCSC)Chr 16: 68.25 – 68.26 MbChr 8: 106.88 – 106.89 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Lizofosfolipaze su enzimi koji djeluju na biološke membrane, kako bi regulirali multifunkcionalne lizofosfolipide. Protein kodiran ovim genom hidrolizira lizofosfatidilholin u glicerofosforilholin i slobodnu masnu kiselinu. Ovaj enzim je prisutan u plazmi i smatra se da je povezan sa lipoproteinom velike gustoćee. Kasniji članak proturječi funkciji ovog gena. Dokazuje da ovaj gen kodira lizosomski enzim umjesto lizofosfolipaze i da ima i kalcij neovisnu fosfolipazu A2 i transakcilazne aktivnosti.[7]

Aminokiselinska sekvenca

Dužina polipeptidnog lanca je 412 aminokiselina, a molekulska težina 46.658 Da.[8]

Simboli
1020304050
MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQ
LEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNK
TSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGY
TRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMG
NMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPV
IGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQ
DIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDR
DPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANAT
TLAYLKRVLLGP

ReferenceUredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000103066 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000031903 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Taniyama Y, Shibata S, Kita S, Horikoshi K, Fuse H, Shirafuji H, Sumino Y, Fujino M (maj 1999). "Cloning and expression of a novel lysophospholipase which structurally resembles lecithin cholesterol acyltransferase". Biochem Biophys Res Commun. 257 (1): 50–6. doi:10.1006/bbrc.1999.0411. PMID 10092508.
  6. ^ Schaloske RH, Dennis EA (Nov 2006). "The phospholipase A2 superfamily and its group numbering system". Biochim Biophys Acta. 1761 (11): 1246–59. doi:10.1016/j.bbalip.2006.07.011. PMID 16973413.
  7. ^ a b "Entrez Gene: LYPLA3 lysophospholipase 3 (lysosomal phospholipase A2)".
  8. ^ "UniProt, Q8NCC3". Pristupljeno 7. 7. 2021.

Dopunska literaturaUredi