Hemokinski ligand 11 (C-X-C motiv) jest protein koji je kod ljudi kodiran genom CXCL11 sa hromosoma 4.[4]

CXCL11
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1RJT

Identifikatori
AliasiCXCL11
Vanjski ID-jeviOMIM: 604852 MGI: 1860203 HomoloGene: 3944 GeneCards: CXCL11
Lokacija gena (čovjek)
Hromosom 4 (čovjek)
Hrom.Hromosom 4 (čovjek)[1]
Hromosom 4 (čovjek)
Genomska lokacija za CXCL11
Genomska lokacija za CXCL11
Bend4q21.1Početak76,033,682 bp[1]
Kraj76,041,415 bp[1]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija chemokine activity
cytokine activity
heparin binding
GO:0001948, GO:0016582 vezivanje za proteine
CXCR3 chemokine receptor binding
Ćelijska komponenta extracellular region
Vanćelijsko
intracellular anatomical structure
Biološki proces Hemotaksija
positive regulation of leukocyte chemotaxis
T cell chemotaxis
chemokine-mediated signaling pathway
response to lipopolysaccharide
cell-cell signaling
positive regulation of release of sequestered calcium ion into cytosol
positive regulation of cAMP-mediated signaling
regulation of cell population proliferation
GO:0046730, GO:0046737, GO:0046738, GO:0046736 Imuni odgovor
GO:0072468 Transdukcija signala
defense response
inflammatory response
antimicrobial humoral immune response mediated by antimicrobial peptide
regulation of signaling receptor activity
G protein-coupled receptor signaling pathway
adenylate cyclase-activating G protein-coupled receptor signaling pathway
neutrophil chemotaxis
leukocyte chemotaxis
cellular response to lipopolysaccharide
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_005409
NM_001302123

NM_019494

RefSeq (bjelančevina)

NP_001289052
NP_005400

NP_062367

Lokacija (UCSC)Chr 4: 76.03 – 76.04 Mbn/a
PubMed pretraga[2][3]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

C-X-C motivni hemokin 11 je mali citokin porodice hemokina CXC, znani kao interferon induciblni T-ćelijski alfa hemoatratant (I-TAC) i "interferon-gama-inducibilni protein 9" (IP-9). Vrlo je eksprimiran u leukocitima periferne krvi, gušterači i jetri, s umjerenim nivoima u timusu, slezeni i plućima i niskim nivoima ekspresijw u tankom crevu, placenti i prostati.[5]

Aminokiselinska sekvenca

uredi

Dužina polipeptidnog lanca je 94 aminokiseline, а molekulska težina 10.365 Da.[6]

1020304050
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASI
MYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

Funkcija

uredi

Ekspresija gena CXCL11 je snažno indukovana interferonima tipa II, IFN-γ i IFN-β, a slabo indukovana iinterferonom IFN-α.[7] Ovaj hemokin izaziva efekte na svoje ciljne ćelije interakcijom sa ćelijskom površinom receptorom hemokina CXCR3, sa većim afinitetom nego drugi ligandi za ovaj receptor, CXCL9 i CXCL10.[5][8] CXCL11 je hemotaksičan za aktivirane T-ćelije . Na ljudskom hromosomu 4, njegov gen nalazi se zajedno sa mnogim drugim članovima porodice hemokina CXC.[9][10]

Biomarkeri

uredi

CXCL9, CXCL-10 i CXCL-11 pokazali su se kao valjani biomarkeri za razvoj srčane insuficijencije i disfunkcije lijeve komore, ukazujući na potcrtavajuću patofiziološku vezu između nivoa ovih hemokina i razvoja štetnog preoblikovanja srca.[11][12]

Reference

uredi
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000169248 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Entrez Gene: CXCL11 chemokine (C-X-C motif) ligand 11".
  5. ^ a b Cole KE, Strick CA, Paradis TJ, Ogborne KT, Loetscher M, Gladue RP, Lin W, Boyd JG, Moser B, Wood DE, Sahagan BG, Neote K (juni 1998). "Interferon-inducible T cell alpha chemoattractant (I-TAC): a novel non-ELR CXC chemokine with potent activity on activated T cells through selective high affinity binding to CXCR3". The Journal of Experimental Medicine. 187 (12): 2009–21. doi:10.1084/jem.187.12.2009. PMC 2212354. PMID 9625760.
  6. ^ "UniProt, O14625" (jezik: engleski). Pristupljeno 24. 10. 2021.
  7. ^ Rani MR, Foster GR, Leung S, Leaman D, Stark GR, Ransohoff RM (septembar 1996). "Characterization of beta-R1, a gene that is selectively induced by interferon beta (IFN-beta) compared with IFN-alpha". The Journal of Biological Chemistry. 271 (37): 22878–84. doi:10.1074/jbc.271.37.22878. PMID 8798467.
  8. ^ Tensen CP, Flier J, Van Der Raaij-Helmer EM, Sampat-Sardjoepersad S, Van Der Schors RC, Leurs R, Scheper RJ, Boorsma DM, Willemze R (maj 1999). "Human IP-9: A keratinocyte-derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3)". The Journal of Investigative Dermatology. 112 (5): 716–22. doi:10.1046/j.1523-1747.1999.00581.x. PMID 10233762.
  9. ^ Erdel M, Laich A, Utermann G, Werner ER, Werner-Felmayer G (1998). "The human gene encoding SCYB9B, a putative novel CXC chemokine, maps to human chromosome 4q21 like the closely related genes for MIG (SCYB9) and INP10 (SCYB10)". Cytogenetics and Cell Genetics. 81 (3–4): 271–2. doi:10.1159/000015043. PMID 9730616. S2CID 46846304.
  10. ^ O'Donovan N, Galvin M, Morgan JG (1999). "Physical mapping of the CXC chemokine locus on human chromosome 4". Cytogenetics and Cell Genetics. 84 (1–2): 39–42. doi:10.1159/000015209. PMID 10343098. S2CID 8087808.
  11. ^ Altara R, Gu YM, Struijker-Boudier HA, Thijs L, Staessen JA, Blankesteijn WM (2015). "Left Ventricular Dysfunction and CXCR3 Ligands in Hypertension: From Animal Experiments to a Population-Based Pilot Study". PLOS ONE. 10 (10): e0141394. Bibcode:2015PLoSO..1041394A. doi:10.1371/journal.pone.0141394. PMC 4624781. PMID 26506526.
  12. ^ Altara R, Manca M, Hessel MH, Gu Y, van Vark LC, Akkerhuis KM, Staessen JA, Struijker-Boudier HA, Booz GW, Blankesteijn WM (august 2016). "CXCL10 Is a Circulating Inflammatory Marker in Patients with Advanced Heart Failure: a Pilot Study". Journal of Cardiovascular Translational Research. 9 (4): 302–14. doi:10.1007/s12265-016-9703-3. PMID 27271043. S2CID 41188765.

Dopunska literatura

uredi

Vanjski linkovi

uredi