STX10

Sintaksin-10 (STX10) jest jedan od SNARE proteina, koji je kod ljudi kodiran genom STX10 sa hromosoma 19.[3] Ovaj protein nalazi se kod većine kičmenjaka (uključujući ljude), ali ga primjetno nema kod miševa.[4][5] Kao i kod ostaliih SNARE proteina, STX10 olakšava fuziju vezikula i stoga je važan za unutarćelijski promet proteina i drugih ćelijskih komponenti. Preciznije, STX10 je upleten u promet endosoma i Golgijevog aparata receptorom manoza 6-fosfata[4] i transporterom glukoze tipa 4.[5]

STX10
Pdb4dnd.png
Dostupne strukture
PDBPretraga Human UniProta: PDBe RCSB
Spisak PDB ID kodova

4DND

Identifikatori
AliasiSTX10
Vanjski ID-jeviOMIM: 603765 HomoloGene: 84379 GeneCards: STX10
Lokacija gena (čovjek)
Hromosom 19 (čovjek)
Hrom.Hromosom 19 (čovjek)[1]
Hromosom 19 (čovjek)
Genomska lokacija za STX10
Genomska lokacija za STX10
Bend19p13.13Početak13,144,058 bp[1]
Kraj13,150,383 bp[1]
Ontologija gena
Molekularna funkcija SNAP receptor activity
syntaxin binding
GO:0001948, GO:0016582 protein binding
SNARE binding
Ćelijska komponenta integral component of membrane
perinuklearno područje citoplazme
Vezikula
Golđijeva membrana
trans-Golđijeva mreža
Golđijev aparat
SNARE complex
membrana
trans-Golgi network membrane
citosol
Sinapsna vezikula
Endomembranski sistem
integral component of synaptic vesicle membrane
intracellular anatomical structure
Biološki proces early endosome to Golgi transport
protein transport
vesicle docking
intracellular protein transport
Fuzija vezikula
retrograde transport, endosome to Golgi
Golgi vesicle transport
vesicle-mediated transport
regulation of protein localization
membrane fusion
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001271609
NM_001271610
NM_001271611
NM_003765

n/a

RefSeq (bjelančevina)

NP_001258538
NP_001258539
NP_001258540
NP_003756

n/a

Lokacija (UCSC)Chr 19: 13.14 – 13.15 Mbn/a
PubMed pretraga[2]n/a
Wikipodaci
Pogledaj/uredi – čovjek

STX10 je otkriven u trans-Golgijevoj mreži (TGN) pomoću imunofluorescencije.[3]


Aminokiselinska sekvencaUredi

Dužina polipeptidnog lanca je 249 aminokiselina, a molekulska težina 28.114 Da.[3]

1020304050
MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNEL
RNGLRSIEWDLEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQ
EMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIE
EQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQ
EMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLFSL

Struktura i funkcijaUredi

Ljudski STX10 je protein od 249 aminokiselina koji ima tri N-terminalna α-heliksa i jedan SNARE domen nakon čega slijedi jednoprolazni transmembranski domen. Ljudski STX10 je 60% identičan ljudskom STX6.[3]

STX10 je strukturno klasifikovan kao Qc-SNARE (doprinosi ostatku glutamina (Q) u formiranju sastavljenog jezgra SNARE kompleksa) i funkcionalno je klasifikovan kao t-SNARE (ili ciljni-SNARE koji se često nalazi u membranama ciljnih odjeljaka).[6]

InterakcijeUredi

Poznato je da STX10 komunicira sa t-SNARE-ovima VTI1A i STX16[7] te sa v-SNARE VAMP3[4] i VAMP4.[7] SNARE kompleks STX10, STX16, VTI1A i VAMP3 je neophodan za kasni prenos endosoma ka Golgijevom manozni 6-fosfatni receptor.[4] Rani promet endosoma ka Golgijevom aparatu za Shiga toksin potreban je SNARE kompleks STX6, STX16, VTI1A i VAMP3 ili VAMP4.[4][8]

Dakle, STX10 diferencira rani promet endosoma u Golgijevom aparatu od kasnog prometa endosomom do Golgijeva kompleksa.[4]

ReferenceUredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000104915 - Ensembl, maj 2017
  2. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  3. ^ a b c d Tang BL, Low DY, Tan AE, Hong W (January 1998). "Syntaxin 10: a member of the syntaxin family localized to the trans-Golgi network". Biochemical and Biophysical Research Communications. 242 (2): 345–50. doi:10.1006/bbrc.1997.7966. PMID 9446797.
  4. ^ a b c d e f Ganley IG, Espinosa E, Pfeffer SR (January 2008). "A syntaxin 10-SNARE complex distinguishes two distinct transport routes from endosomes to the trans-Golgi in human cells" (PDF). The Journal of Cell Biology. 180 (1): 159–72. doi:10.1083/jcb.200707136. PMC 2213607. PMID 18195106.
  5. ^ a b Esk C, Chen CY, Johannes L, Brodsky FM (January 2010). "The clathrin heavy chain isoform CHC22 functions in a novel endosomal sorting step". The Journal of Cell Biology. 188 (1): 131–44. doi:10.1083/jcb.200908057. PMC 2812854. PMID 20065094.
  6. ^ Hong W (July 2005). "SNAREs and traffic". Biochimica et Biophysica Acta (BBA) - Molecular Cell Research. 1744 (3): 493–517. doi:10.1016/j.bbamcr.2005.03.014. PMID 16038056.
  7. ^ a b Wang Y, Tai G, Lu L, Johannes L, Hong W, Tang BL (Jul–Aug 2005). "Trans-Golgi network syntaxin 10 functions distinctly from syntaxins 6 and 16". Molecular Membrane Biology. 22 (4): 313–25. doi:10.1080/09687860500143829. PMID 16154903. S2CID 25014829.
  8. ^ Mallard F, Tang BL, Galli T, Tenza D, Saint-Pol A, Yue X, Antony C, Hong W, Goud B, Johannes L (February 2002). "Early/recycling endosomes-to-TGN transport involves two SNARE complexes and a Rab6 isoform". The Journal of Cell Biology. 156 (4): 653–64. doi:10.1083/jcb.200110081. PMC 2174079. PMID 11839770.

Vanjski linkoviUredi

  • PDBe-KB provides an overview of all the structure information available in the PDB for Human Syntaxin-10 (STX10)