Jedarni protein 1 je protein koji je kod ljudi kodiran genom NUPR1.[5][6][7][8]

NUPR1
Identifikatori
AliasiNUPR1
Vanjski ID-jeviOMIM: 614812 MGI: 1891834 HomoloGene: 8229 GeneCards: NUPR1
Lokacija gena (čovjek)
Hromosom 16 (čovjek)
Hrom.Hromosom 16 (čovjek)[1]
Hromosom 16 (čovjek)
Genomska lokacija za NUPR1
Genomska lokacija za NUPR1
Bend16p11.2Početak28,532,708 bp[1]
Kraj28,539,008 bp[1]
Lokacija gena (miš)
Hromosom 7 (miš)
Hrom.Hromosom 7 (miš)[2]
Hromosom 7 (miš)
Genomska lokacija za NUPR1
Genomska lokacija za NUPR1
Bend7|7 F3Početak126,222,421 bp[2]
Kraj126,230,033 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija chromatin binding
vezivanje sa DNK
GO:0001948, GO:0016582 vezivanje za proteine
GO:0001105 transcription coactivator activity
acetyltransferase activator activity
Ćelijska komponenta jedro
citosol
protein-DNA complex
citoplazma
perinuklearno područje citoplazme
Biološki proces skeletal muscle cell differentiation
intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
negative regulation of cell cycle
male gonad development
GO:0009373 regulation of transcription, DNA-templated
acute inflammatory response
negative regulation of fibroblast proliferation
regulation of female gonad development
response to toxic substance
transcription, DNA-templated
protein acetylation
positive regulation of protein modification process
positive regulation of apoptotic process
GO:0044324, GO:0003256, GO:1901213, GO:0046019, GO:0046020, GO:1900094, GO:0061216, GO:0060994, GO:1902064, GO:0003258, GO:0072212 regulation of transcription by RNA polymerase II
Ćelijska proliferacija
GO:0034622 protein-containing complex assembly
negative regulation of cell population proliferation
GO:0048554 positive regulation of catalytic activity
positive regulation of proteasomal protein catabolic process
positive regulation of nucleic acid-templated transcription
regulation of autophagy
negative regulation of autophagy
negative regulation of cardiac muscle cell apoptotic process
negative regulation of apoptotic process
negative regulation of DNA-binding transcription factor activity
positive regulation of neuron apoptotic process
negative regulation of glycolytic process
negative regulation of epithelial cell proliferation
negative regulation of programmed necrotic cell death
positive regulation of neuroinflammatory response
negative regulation of autophagosome assembly
positive regulation of oxidative phosphorylation
negative regulation of epithelial cell apoptotic process
negative regulation of type B pancreatic cell proliferation
regulation of response to endoplasmic reticulum stress
positive regulation of intrinsic apoptotic signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_012385
NM_001042483

NM_019738

RefSeq (bjelančevina)

NP_001035948
NP_036517

NP_062712

Lokacija (UCSC)Chr 16: 28.53 – 28.54 MbChr 7: 126.22 – 126.23 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Popoću PCR-analize hibridnih ljudskih i glodarkih ćelijai i analizom baza podataka, gen NUPR1 mapiran je na na hromosomu 16, regija 16p11.2.

Aminokiselinska sekvenca

uredi

Dužina polipeptidnog lanca je 82 aminokiseline, a molekulska težina 8.873 Da.[9].

Simboli
1020304050
MATFPPATSAPQQPPGPEDEDSSLDESDLYSLAHSYLGGGGRKGRTKREA
AANTNRPSPGGHERKLVTKLQNSERKKRGARR

Reference

uredi
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000176046 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000030717 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Mallo GV, Fiedler F, Calvo EL, Ortiz EM, Vasseur S, Keim V, Morisset J, Iovanna JL (Jan 1998). "Cloning and expression of the rat p8 cDNA, a new gene activated in pancreas during the acute phase of pancreatitis, pancreatic development, and regeneration, and which promotes cellular growth". J Biol Chem. 272 (51): 32360–9. doi:10.1074/jbc.272.51.32360. PMID 9405444.
  6. ^ Ree AH, Tvermyr M, Engebraaten O, Rooman M, Rosok O, Hovig E, Meza-Zepeda LA, Bruland OS, Fodstad O (Oct 1999). "Expression of a novel factor in human breast cancer cells with metastatic potential". Cancer Res. 59 (18): 4675–80. PMID 10493524.
  7. ^ Vasseur S, Vidal Mallo G, Fiedler F, Bodeker H, Canepa E, Moreno S, Iovanna JL (Apr 1999). "Cloning and expression of the human p8, a nuclear protein with mitogenic activity". Eur J Biochem. 259 (3): 670–5. doi:10.1046/j.1432-1327.1999.00092.x. PMID 10092851.
  8. ^ "Entrez Gene: NUPR1 nuclear protein 1".
  9. ^ "UniProt, O60356". Pristupljeno 8. 7. 2021.

Dopunska literatura

uredi