LRRC15

Protein 15 sa leucinom bogatim ponavljanjem jest protein koji je kod ljudi kodiran genom LRRC15 sa hromosoma 3.[5]

LRRC15
Identifikatori
AliasiLRRC15
Vanjski ID-jeviMGI: 1921738 HomoloGene: 26080 GeneCards: LRRC15
Lokacija gena (čovjek)
Hromosom 3 (čovjek)
Hrom.Hromosom 3 (čovjek)[1]
Hromosom 3 (čovjek)
Genomska lokacija za LRRC15
Genomska lokacija za LRRC15
Bend3q29Početak194,355,249 bp[1]
Kraj194,369,743 bp[1]
Lokacija gena (miš)
Hromosom 16 (miš)
Hrom.Hromosom 16 (miš)[2]
Hromosom 16 (miš)
Genomska lokacija za LRRC15
Genomska lokacija za LRRC15
Bend16|16 B2Početak30,088,120 bp[2]
Kraj30,102,074 bp[2]
Ontologija gena
Molekularna funkcija fibronectin binding
protein kinase inhibitor activity
laminin binding
collagen binding
Ćelijska komponenta citoplazma
integral component of membrane
Egzosom
membrana
Vanćelijsko
GO:0005578 Vanćelijski matriks
collagen-containing extracellular matrix
Biološki proces negative regulation of protein kinase activity
cytokine-mediated signaling pathway
negative regulation of receptor signaling pathway via JAK-STAT
positive regulation of cell migration
negative regulation of protein localization to plasma membrane
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_130830
NM_001135057

NM_028973

RefSeq (bjelančevina)

NP_001128529
NP_570843

NP_083249

Lokacija (UCSC)Chr 3: 194.36 – 194.37 MbChr 16: 30.09 – 30.1 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Aminokiselinska sekvencaUredi

Dužina polipeptidnog lanca je 581 aminokiselina, а molekulska težina 64.366 Da.[6].

1020304050
MPLKHYLLLLVGCQAWGAGLAYHGCPSECTCSRASQVECTGARIVAVPTP
LPWNAMSLQILNTHITELNESPFLNISALIALRIEKNELSRITPGAFRNL
GSLRYLSLANNKLQVLPIGLFQGLDSLESLLLSSNQLLQIQPAHFSQCSN
LKELQLHGNHLEYIPDGAFDHLVGLTKLNLGKNSLTHISPRVFQHLGNLQ
VLRLYENRLTDIPMGTFDGLVNLQELALQQNQIGLLSPGLFHNNHNLQRL
YLSNNHISQLPPSVFMQLPQLNRLTLFGNSLKELSPGIFGPMPNLRELWL
YDNHISSLPDNVFSNLRQLQVLILSRNQISFISPGAFNGLTELRELSLHT
NALQDLDGNVFRMLANLQNISLQNNRLRQLPGNIFANVNGLMAIQLQNNQ
LENLPLGIFDHLGKLCELRLYDNPWRCDSDILPLRNWLLLNQPRLGTDTV
PVCFSPANVRGQSLIIINVNVAVPSVHVPEVPSYPETPWYPDTPSYPDTT
SVSSTTELTSPVEDYTDLTTIQVTDDRSVWGMTQAQSGLAIAAIVIGIVA
LACSLAACVGCCCCKKRSQAVLMQMKAPNEC

ReferenceUredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000172061 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000052316 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ "Entrez Gene: Leucine rich repeat containing 15".
  6. ^ "UniProt, Q8TF66" (jezik: engleski). Pristupljeno 8. 11. 2021.

Dopunska literaturaUredi