THBS3

Trombospondin-3 (TSP3) jest protein koji je kod ljudi kodiran genom THBS3 sa hromosoma 1.[5][6]

THBS3
Identifikatori
AliasiTHBS3
Vanjski ID-jeviOMIM: 188062 MGI: 98739 HomoloGene: 5159 GeneCards: THBS3
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za THBS3
Genomska lokacija za THBS3
Bend1q22Početak155,195,588 bp[1]
Kraj155,209,051 bp[1]
Lokacija gena (miš)
Hromosom 3 (miš)
Hrom.Hromosom 3 (miš)[2]
Hromosom 3 (miš)
Genomska lokacija za THBS3
Genomska lokacija za THBS3
Bend3 F1|3 39.01 cMPočetak89,122,487 bp[2]
Kraj89,134,144 bp[2]
Obrazac RNK ekspresije
PBB GE THBS3 209561 at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija calcium ion binding
heparin binding
extracellular matrix structural constituent
Ćelijska komponenta perinuklearno područje citoplazme
extracellular region
GO:0005578 Vanćelijski matriks
Vanćelijsko
collagen-containing extracellular matrix
Biološki proces growth plate cartilage development
ossification involved in bone maturation
cell-matrix adhesion
Ćelijska adhezija
bone trabecula formation
extracellular matrix organization
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001252607
NM_001252608
NM_007112

NM_013691

RefSeq (bjelančevina)

NP_001239536
NP_001239537
NP_009043

NP_038719

Lokacija (UCSC)Chr 1: 155.2 – 155.21 MbChr 3: 89.12 – 89.13 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Aminokiselinska sekvencaUredi

Dužina polipeptidnog lanca je 956 aminokiselina, a molekulska težina 104.201 Da.[7]

1020304050
METQELRGALALLLLCFFTSASQDLQVIDLLTVGESRQMVAVAEKIRTAL
LTAGDIYLLSTFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRY
QREDGKVHAVNLQQAGLADGRTHTVLLRLRGPSRPSPALHLYVDCKLGDQ
HAGLPALAPIPPAEVDGLEIRTGQKAYLRMQGFVESMKIILGGSMARVGA
LSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQILVELRDDIR
DQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECAHADPCFPGSSCINTMPGFHCEACPRGYKG
TQVSGVGIDYARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGPC
RLGFLGNQSQGCLPARTCHSPAHSPCHIHAHCLFERNGAVSCQCNVGWAG
NGNVCGTDTDIDGYPDQALPCMDNNKHCKQDNCLLTPNSGQEDADNDGVG
DQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQ
KDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDS
DNDGLGDECDGDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCE
DDFDNDAVVDPLDVCPESAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLN
QGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFLFSYQD
SGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSGPGEHLRNALW
HTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTSMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQ
LLQGRV

FunkcijaUredi

Protein kodiran ovim genom pripada porodici trombospondina. Članovi porodice trombospondina su adhezivni glikoproteini koji posreduju u interakcijama ćelija-ćelija i ćelija-matriks. Utvrđeno je da je TSP3 uključen u regulaciju sazrijevanja skeleta.[8] Ovaj protein formira pentamernu molekulu povezanu jednom disulfidnom vezom. Ovaj gen dijeli zajednički promotor s metaksinom 1.[6] Identificiran je kao gen na hromosomu 1, odgovoran za posredovanje vze s genetskičm osjetljivošću na infekcije SARS-CoV-2.[9]

ReferenceUredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000169231 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000028047 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Vos HL, Devarayalu S, de Vries Y, Bornstein P (Jul 1992). "Thrombospondin 3 (Thbs3), a new member of the thrombospondin gene family". J Biol Chem. 267 (17): 12192–6. doi:10.1016/S0021-9258(19)49823-2. PMID 1601886.
  6. ^ a b "Entrez Gene: THBS3 thrombospondin 3".
  7. ^ "UniProt, P49746" (jezik: engleski). Pristupljeno 20. 12. 2017.
  8. ^ Hankenson, Kurt (juli 2005). "Mice with a Disruption of the Thrombospondin 3 Gene Differ in Geometric and Biomechanical Properties of Bone and Have Accelerated Development of the Femoral Head". Molecular and Cellular Biology. 25 (13): 5599–5606. doi:10.1128/MCB.25.13.5599-5606.2005. PMC 1156967. PMID 15964815.
  9. ^ "Mapping the human genetic architecture of COVID-19". Nature. juli 2021. doi:10.1038/s41586-021-03767-x. PMID 34237774 Provjerite vrijednost parametra |pmid= (pomoć). S2CID 235776838 Provjerite vrijednost parametra |s2cid= (pomoć).

Dopunsdka literaturaUredi