Lučeni Ly-6/uPAR-srodni protein 1 je protein koji je kod ljudi kodiran genom SLURP1.[5][6][7] Ima protivupalno djelovanje, kao supresor tumora i antagonizira nikotinske receptore.[8]

SLURP1
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2MUP, 2MUO

Identifikatori
AliasiSLURP1
Vanjski ID-jeviOMIM: 606119 MGI: 1930923 HomoloGene: 10710 GeneCards: SLURP1
Lokacija gena (čovjek)
Hromosom 8 (čovjek)
Hrom.Hromosom 8 (čovjek)[1]
Hromosom 8 (čovjek)
Genomska lokacija za SLURP1
Genomska lokacija za SLURP1
Bend8q24.3Početak142,740,949 bp[1]
Kraj142,742,406 bp[1]
Lokacija gena (miš)
Hromosom 15 (miš)
Hrom.Hromosom 15 (miš)[2]
Hromosom 15 (miš)
Genomska lokacija za SLURP1
Genomska lokacija za SLURP1
Bend15|15 D3Početak74,596,167 bp[2]
Kraj74,599,883 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija cytokine activity
acetylcholine receptor activator activity
GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta Egzosom
Vanćelijsko
extracellular region
Biološki proces Ćelijska adhezija
negative regulation of keratinocyte proliferation
neuromuscular process controlling posture
locomotory behavior
cell activation
negative regulation of cell population proliferation
negative regulation of cell migration
urokinase plasminogen activator signaling pathway
positive regulation of signaling receptor activity
regulation of signaling receptor activity
regulation of neurotransmitter receptor activity
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_020427

NM_020519

RefSeq (bjelančevina)

NP_065160

NP_065265

Lokacija (UCSC)Chr 8: 142.74 – 142.74 MbChr 15: 74.6 – 74.6 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Aminokiselinska sekvenca

uredi

Dužina polipeptidnog lanca je 103 aminokiseline, а molekulska težina 11.186 Da.[9]

1020304050
MASRWAVQLLLVAAWSMGCGEALKCYTCKEPMTSASCRTITRCKPEDTAC
MTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCN
SEL

Funkcija

uredi

Protein kodiran ovim genom član je porodice Ly6/uPAR, ali mu nedostaje signalna sekvenca za sidrenje GPI. Izlučuje se u krv[6], a ponekad se nalazi i u spermi, kada se ekstrahira u zigot koji se veže za receptor α7-acetilholina.[8] Prikazano je da djeluje kao endogeni supresor tumora smanjujući migraciju i invaziju stanica posredujući svoj vlastiti antitumorski učinak i antagonizirajući pro-maligne učinke nikotina.[8]

Mutacije u ovom genu povezane su s mljetskom bolešči (Mal de Meleda), rijetkim autosomno recesivnim kožnim poremećajem kojeg karakterizira upalna dlanskotabanska hiperkeratoza. To je posljedica gubitka SLURP1, što dovodi do disfunkcionalne epitelne diferencijacije.[10] and an increased secretion of the inflammatory cytokines TNFα, IL1, IL-6, and IL-8.[11][12]

Ovaj gen nalazi se u istoj hromosomskoj regiji kao i nekoliko članova porodice glikoproteinskih receptora Ly6/uPAR.[7]

Reference

uredi
  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000126233 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000022596 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Fischer J, Bouadjar B, Heilig R, Huber M, Lefèvre C, Jobard F, Macari F, Bakija-Konsuo A, Ait-Belkacem F, Weissenbach J, Lathrop M, Hohl D, Prud'homme JF (april 2001). "Mutations in the gene encoding SLURP-1 in Mal de Meleda". Human Molecular Genetics. 10 (8): 875–80. doi:10.1093/hmg/10.8.875. PMID 11285253.
  6. ^ a b Adermann K, Wattler F, Wattler S, Heine G, Meyer M, Forssmann WG, Nehls M (april 1999). "Structural and phylogenetic characterization of human SLURP-1, the first secreted mammalian member of the Ly-6/uPAR protein superfamily". Protein Science. 8 (4): 810–9. doi:10.1110/ps.8.4.810. PMC 2144295. PMID 10211827.
  7. ^ a b "Entrez Gene: SLURP1 secreted LY6/PLAUR domain containing 1".
  8. ^ a b c Throm VM, Männle D, Giese T, Bauer AS, Gaida MM, Kopitz J, Bruckner T, Plaschke K, Grekova SP, Felix K, Hackert T, Giese NA, Strobel O (februar 2018). "Endogenous CHRNA7-ligand SLURP1 as a potential tumor suppressor and anti-nicotinic factor in pancreatic cancer". Oncotarget. 9 (14): 11734–11751. doi:10.18632/oncotarget.24312. PMC 5837762. PMID 29545933.
  9. ^ "UniProt, P55000" (jezik: engleski). Pristupljeno 21. 9. 2021.
  10. ^ Favre B, Plantard L, Aeschbach L, Brakch N, Christen-Zaech S, de Viragh PA, Sergeant A, Huber M, Hohl D (februar 2007). "SLURP1 is a late marker of epidermal differentiation and is absent in Mal de Meleda". The Journal of Investigative Dermatology. 127 (2): 301–8. doi:10.1038/sj.jid.5700551. PMID 17008884.
  11. ^ Swamynathan S, Buela KA, Kinchington P, Lathrop KL, Misawa H, Hendricks RL, Swamynathan SK (decembar 2012). "Klf4 regulates the expression of Slurp1, which functions as an immunomodulatory peptide in the mouse cornea". Investigative Ophthalmology & Visual Science. 53 (13): 8433–46. doi:10.1167/iovs.12-10759. PMC 4113333. PMID 23139280.
  12. ^ Chernyavsky AI, Galitovskiy V, Shchepotin IB, Grando SA (2014). "Anti-inflammatory effects of the nicotinergic peptides SLURP-1 and SLURP-2 on human intestinal epithelial cells and immunocytes". BioMed Research International. 2014: 609086. doi:10.1155/2014/609086. PMC 4024406. PMID 24877120.

Dopunska literatura

uredi