Rac2 (Ras-srodni C3 botulinum toksinski sustrat) je mali (~21 kDa) signalni G-protein (specifična GTPaza), član potporodice Rac-proteina u porodici Rho GTPaza, jest protein koji je kod ljudi kodiran genom sa hromosoma 22.[5][6]

RAC2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

1DS6, 2W2T, 2W2V, 2W2X

Identifikatori
AliasiRAC2
Vanjski ID-jeviOMIM: 602049 MGI: 97846 HomoloGene: 55699 GeneCards: RAC2
Lokacija gena (čovjek)
Hromosom 22 (čovjek)
Hrom.Hromosom 22 (čovjek)[1]
Hromosom 22 (čovjek)
Genomska lokacija za RAC2
Genomska lokacija za RAC2
Bend22q13.1Početak37,225,270 bp[1]
Kraj37,244,448 bp[1]
Lokacija gena (miš)
Hromosom 15 (miš)
Hrom.Hromosom 15 (miš)[2]
Hromosom 15 (miš)
Genomska lokacija za RAC2
Genomska lokacija za RAC2
Bend15|15 E1Početak78,443,367 bp[2]
Kraj78,456,983 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija nucleotide binding
GTP binding
protein kinase regulator activity
GO:0006184 GTPase activity
GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta citoplazma
citosol
phagocytic vesicle membrane
nuclear envelope
membrana
focal adhesion
ćelijska membrana
Mikronit
Egzosom
lamellipodium
intracellular anatomical structure
Biološki proces regulation of respiratory burst
lymphocyte aggregation
regulation of T cell proliferation
positive regulation of protein targeting to mitochondrion
regulation of hydrogen peroxide metabolic process
actin filament organization
regulation of cell-substrate adhesion
regulation of neutrophil migration
bone resorption
platelet activation
Hemotaksija
cell projection assembly
positive regulation of cell population proliferation
regulation of mast cell chemotaxis
positive regulation of neutrophil chemotaxis
regulation of mast cell degranulation
regulation of protein kinase activity
positive regulation of lamellipodium assembly
regulation of small GTPase mediated signal transduction
actin cytoskeleton organization
GO:0072468 Transdukcija signala
small GTPase mediated signal transduction
G protein-coupled receptor signaling pathway
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_002872

NM_009008

RefSeq (bjelančevina)

NP_002863

NP_033034

Lokacija (UCSC)Chr 22: 37.23 – 37.24 MbChr 15: 78.44 – 78.46 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Aminokiselinska sekvenca uredi

Dužina polipeptidnog lanca je 192 aminokiseline, a molekulska težina 21.429 Da.[6]

1020304050
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKP
VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPE
VRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEID
SVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL

Funkcija uredi

Članovi Rho porodice GTPaza reguliraju raznolik niz ćelijskih događaja, uključujući kontrolu rasta ćelija, reorganizaciju citoskeleta i aktivaciju protein ]]kinaza]].[6]

Interakcije uredi

Pokazalo se da Rac2 reaguje sa ARHGDIA[7][8] i dušik-oksid sintazom 2A.[9]

Također pogledajte uredi

Reference uredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000128340 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000033220 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Ridley AJ (2006). "Rho GTPases and actin dynamics in membrane protrusions and vesicle trafficking". Trends Cell Biol. 16 (10): 522–9. doi:10.1016/j.tcb.2006.08.006. PMID 16949823.
  6. ^ a b c "Entrez Gene: RAC2 ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)".
  7. ^ Gorvel JP, Chang TC, Boretto J, Azuma T, Chavrier P (January 1998). "Differential properties of D4/LyGDI versus RhoGDI: phosphorylation and rho GTPase selectivity". FEBS Lett. 422 (2): 269–73. doi:10.1016/S0014-5793(98)00020-9. PMID 9490022. S2CID 10817327.
  8. ^ Fauré J, Dagher MC (May 2001). "Interactions between Rho GTPases and Rho GDP dissociation inhibitor (Rho-GDI)". Biochimie. 83 (5): 409–14. doi:10.1016/S0300-9084(01)01263-9. PMID 11368848.
  9. ^ Kuncewicz T, Balakrishnan P, Snuggs MB, Kone BC (August 2001). "Specific association of nitric oxide synthase-2 with Rac isoforms in activated murine macrophages". Am. J. Physiol. Renal Physiol. 281 (2): F326-36. doi:10.1152/ajprenal.2001.281.2.F326. PMID 11457725.

Dopunska literatura uredi

Vanjski linkovi uredi

Šablon:Rho porodica GTPaza