Uparena kutija gena 8, poznata i kao PAX8, jest protein koji je kod ljudi kodiran genom PAX8 sa hromosoma 2.[5]

PAX8
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

2K27

Identifikatori
AliasiPAX8
Vanjski ID-jeviOMIM: 167415 MGI: 97492 HomoloGene: 2589 GeneCards: PAX8
Lokacija gena (čovjek)
Hromosom 2 (čovjek)
Hrom.Hromosom 2 (čovjek)[1]
Hromosom 2 (čovjek)
Genomska lokacija za PAX8
Genomska lokacija za PAX8
Bend2q14.1Početak113,215,997 bp[1]
Kraj113,278,921 bp[1]
Lokacija gena (miš)
Hromosom 2 (miš)
Hrom.Hromosom 2 (miš)[2]
Hromosom 2 (miš)
Genomska lokacija za PAX8
Genomska lokacija za PAX8
Bend2 A3|2 16.43 cMPočetak24,310,572 bp[2]
Kraj24,365,611 bp[2]
Obrazac RNK ekspresije




Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija DNA binding
sequence-specific DNA binding
GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
GO:0001077, GO:0001212, GO:0001213, GO:0001211, GO:0001205 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
thyroid-stimulating hormone receptor activity
GO:0001948, GO:0016582 protein binding
RNA polymerase II core promoter sequence-specific DNA binding
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
Ćelijska komponenta Nukleoplazma
Jedro
Biološki proces regulation of apoptotic process
pronephros development
regulation of metanephric nephron tubule epithelial cell differentiation
Ćelijska diferencijacija
mesonephric tubule development
positive regulation of branching involved in ureteric bud morphogenesis
kidney epithelium development
GO:0009373 regulation of transcription, DNA-templated
positive regulation of metanephric DCT cell differentiation
negative regulation of mesenchymal cell apoptotic process involved in metanephric nephron morphogenesis
negative regulation of apoptotic process involved in metanephric collecting duct development
Nefrogeneza
pronephric field specification
positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis
anatomical structure morphogenesis
metanephric epithelium development
mesenchymal to epithelial transition involved in metanephros morphogenesis
transcription by RNA polymerase II
regulation of thyroid-stimulating hormone secretion
transcription, DNA-templated
otic vesicle development
metanephric distal convoluted tubule development
negative regulation of mesenchymal cell apoptotic process involved in metanephros development
mesonephros development
GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
metanephric nephron tubule formation
multicellular organism development
central nervous system development
metanephric comma-shaped body morphogenesis
branching involved in ureteric bud morphogenesis
thyroid gland development
positive regulation of thyroid hormone generation
negative regulation of apoptotic process involved in metanephric nephron tubule development
S-shaped body morphogenesis
inner ear morphogenesis
urogenital system development
sulfur compound metabolic process
metanephric S-shaped body morphogenesis
metanephros development
cellular response to gonadotropin stimulus
GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
thyroid-stimulating hormone signaling pathway
negative regulation of cardiac muscle cell apoptotic process
ventricular septum development
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_003466
NM_013951
NM_013952
NM_013953
NM_013992

NM_011040

RefSeq (bjelančevina)

NP_003457
NP_039246
NP_039247
NP_054698

NP_035170

Lokacija (UCSC)Chr 2: 113.22 – 113.28 MbChr 2: 24.31 – 24.37 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Amiokiselininska sekvenca uredi

Dužina polipeptidnog lanca je 450 aminokiselina, a molekulska težina 48.218 Da.[6]

1020304050
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQ
LRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNP
TMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVAT
KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD
SDQDSCRLSIDSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYA
SPSHTKGEQGLYPLPLLNSTLDDGKATLTPSNTPLGRNLSTHQTYPVVAD
PHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAAS
VYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEY
SGNAYGHTPYSSYSEAWRFPNSSLLSSPYYYSSTSRPSAPPTTATAFDHL

Funkcija uredi

Ovaj gen je član porodice transkripijskih faktora uparene kutije (PAX). Članovi ove porodice gena obično kodiraju proteine koji sadrže upareni kutijski domen, oktapeptid i upareni tip homeodomena. Porodica PAX gena ima važnu ulogu u formiranju tkiva i organa tokom embrionskog razvoja i održavanju normalne funkcije nekih ćelija nakon rođenja. PAX geni daju upute za stvaranje proteina koji se vežu za određena područja DNK.[7] Ovaj jedarni protein uključen je u folikulne ćelije štitne žlijezde razvoj i ekspresiju gena specifičnih za štitnjaču. PAX8 oslobađa hormone važne za regulaciju rasta, razvoja mozga i metabolizma. Također funkcionira u vrlo ranim fazama organogeneze bubrega, müllerovog sistema i timusa.|[8] Osim toga, PAX8 se eksprimira u bubrežnom ekskretornom sistemu, epitelnim ćelijama endocerviksa, endometriju, jajnicima, jajovodu, sjemeničkim vezikulama, epididimisu, čelijma otočića pankreasa i limfoidnim ćelijama.[9] PAX8 i ostali transkripcijski faktori imaju ulogu u vezanju DNK i regulaciji gena u sintezi tiroidnih hormona (Tg, TPO, Slc5a5 i Tshr).

PAX8 (i PAX2) je jedan od važnih regulatora morfogeneze urogenitalnog sistema. Oni imaju ulogu u specifikaciji prvih bubrežnih ćelija embrija i ostaju ključni faktori tokom cijelog razvoja.[10]

Pokazalo se da PAX8 ima interakcije sa NK2 homeoboks 1.[11]

Klinički značaj uredi

PAX8 gen je također povezan s kongenitalnom hipotireozom zbog disgeneze štitnjače i svoje uloge u rastu i razvoju štitne žlijezde. Mutacija gena PAX8 mogla bi spriječiti ili poremetiti normalan razvoj. Ove mutacije mogu uticati na različite funkcije proteina, uključujući vezivanje DNK, aktivaciju gena, stabilnost proteina i saradnju sa koaktivatorom p300. Nedostaci PAX gena mogu rezultirati razvojnim defektima koji se nazivaju kongenitalne anomalije bubrega i urinarnog trakta (CAKUT).

Rak uredi

PAX8 mutacije su povezane s različitim oblicima raka.

Mehanizmi uredi

PAX8 se smatra "master regulatornim faktorom transkripcije".[9] Kao glavni regulator, moguće je da regulira ekspresiju gena koji nisu specifični za štitnjaču. Nekoliko poznatih gena supresora tumora poput TP53 i WT1 identificirano je kao mete transkripcije u ljudskim ćelijama astrocitoma. Preko 90% tumora štitnjače nastaje iz folikulnih ćelija štitnjače.[9]Fuzijski protein, PAX8-PPAR-γ, uključen je u neke folikulne karcinome štitnjače i folikulne varijante papilskog karcinoma štitnjače.[12] Mehanizam za ovu transformaciju nije dobro shvaćen, ali postoji nekoliko predloženih mogućnosti.[13][14][15]

  • Inhibicija normalne funkcije PPARy himernim PAX8/PPARy proteinom putem dominantnog negativnog efekta;
  • Aktivacija normalnih PPARy ciljeva zbog prekomjerne ekspresije himernog proteina koji sadrži sve funkcionalne domene divljeg tipa PPAR y;
  • Deregulacija funkcije PAX8;
  • Aktivacija skupa gena koji nisu povezani ni s divljim tipom PPARy ni sa divljim tipom PAX8 puteva

PAX 8 gen ima određenu povezanost s folikularnim tumorima štitnjače. Uočeno je da PAX8/PPAR y-pozitivni tumori rijetko izražavaju RAS mutacije u kombinaciji. Ovo sugerira da se folikulni karcinomi razvijaju na dva različita puta ili sa PAX8/PPAR y ili RAS.

Karakterizirane su alternativne transkripcijske varijante prerade, koje kodiraju različite izoforme.[5] Mehanizam uključivanja gena je nepoznat. Neke studije sugeriraju da bubrežni PAX geni djeluju kao faktori za preživljavanje i omogućavaju tumorskim ćelijama da se odupru apoptozi. Smanjenje ekspresije PAX gena inhibira rast ćelija i indukuje apoptozu. Ovo bi mogao biti mogući put za terapijske ciljeve kod raka bubrega.

Neke studije sekvenciranja cijelog genoma pokazale su da PAX8 također cilja na BRCA1 (kancerogeneza), MAPK puteve (zloćudni tumori štitne žlijezde) i Ccnb1 i Ccnb2 (procesi ćelijskog ciklusa). Pokazalo se da je PAX8 uključen u proliferaciju i diferencijaciju tumorskih ćelija, transdukciju signala, apoptozu, polarnost i transport ćelija, pokretljivost i adheziju ćelija.[9]

Pridruženi tipovi kancera uredi

Mutacije o]]vog gena su povezane sa disgenezom štitne žlezde, folikulskim karcinomom štitne žlijezde i atipskim folikulnim adenomom štitne žlijezde.

PAX8/PPARy preuređenje čini 30-40% folikulnih karcinoma konvencionalnog tipa.,[16] i manje od 5% onkocitnih karcinoma (tzv. neoplazme Hurthleovih ćelija).[17]

Ekspresija PAX8 je povećana u neoplazijskim bubrežnim tkivima, Wilmsovim tumorima, raku jajnika i Müllerovim karcinomima. Iz tog razloga, imunodetekcija PAX8 se široko koristi za dijagnosticiranje primarnih i metastatskih tumora bubrega. Reaktivacija ekspresije PAX8 (ili Pax2) prijavljena je kod pedijatrijskih Wilmsovih tumora, skoro svih podtipova karcinoma bubrežnih ćelija, nefrogenih adenoma, ćelija karcinoma jajnika, mokraćne bešike, prostate i karcinoma endometrija.[10] Ekspresija PAX8 je također indukovana tokom razvoja raka grlića materice.[18]

Tumori koji eksprimiraju PAX8/PPARy obično su prisutni u mladoj dobi, male veličine, prisutni u čvrstom/ugniježđenom obrascu rasta i često uključuju vaskularnu invaziju.

Također pogledajte uredi

Reference uredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000125618 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000026976 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b "Entrez Gene: PAX8 paired box gene 8".
  6. ^ "UniProt, Q06710" (jezik: engleski). Pristupljeno 18. 11. 2021.
  7. ^ "PAX8 gene". Genetics Home Reference. 28. 3. 2016. Pristupljeno 5. 4. 2016.
  8. ^ Laury AR, Perets R, Piao H, Krane JF, Barletta JA, French C, Chirieac LR, Lis R, Loda M, Hornick JL, Drapkin R, Hirsch MS (juni 2011). "A comprehensive analysis of PAX8 expression in human epithelial tumors". The American Journal of Surgical Pathology. 35 (6): 816–26. doi:10.1097/PAS.0b013e318216c112. PMID 21552115. S2CID 14297595.
  9. ^ a b c d Fernández LP, López-Márquez A, Santisteban P (januar 2015). "Thyroid transcription factors in development, differentiation and disease". Nature Reviews. Endocrinology. 11 (1): 29–42. doi:10.1038/nrendo.2014.186. hdl:10261/117036. PMID 25350068. S2CID 39778077.
  10. ^ a b Sharma R, Sanchez-Ferras O, Bouchard M (august 2015). "Pax genes in renal development, disease and regeneration". Seminars in Cell & Developmental Biology. Paramutation & Pax Transcription Factors. 44: 97–106. doi:10.1016/j.semcdb.2015.09.016. PMID 26410163.
  11. ^ Di Palma T, Nitsch R, Mascia A, Nitsch L, Di Lauro R, Zannini M (januar 2003). "The paired domain-containing factor Pax8 and the homeodomain-containing factor TTF-1 directly interact and synergistically activate transcription". The Journal of Biological Chemistry. 278 (5): 3395–402. doi:10.1074/jbc.M205977200. PMID 12441357.
  12. ^ Raman P, Koenig RJ (oktobar 2014). "Pax-8-PPAR-γ fusion protein in thyroid carcinoma". Nature Reviews. Endocrinology. 10 (10): 616–23. doi:10.1038/nrendo.2014.115. PMC 4290886. PMID 25069464.
  13. ^ Rüsch A, Erway LC, Oliver D, Vennström B, Forrest D (decembar 1998). "Thyroid hormone receptor beta-dependent expression of a potassium conductance in inner hair cells at the onset of hearing". Proceedings of the National Academy of Sciences of the United States of America. 95 (26): 15758–62. Bibcode:1998PNAS...9515758R. doi:10.1073/pnas.95.26.15758. PMC 28117. PMID 9861043.
  14. ^ Weiss RE, Xu J, Ning G, Pohlenz J, O'Malley BW, Refetoff S (april 1999). "Mice deficient in the steroid receptor co-activator 1 (SRC-1) are resistant to thyroid hormone". The EMBO Journal. 18 (7): 1900–4. doi:10.1093/emboj/18.7.1900. PMC 1171275. PMID 10202153.
  15. ^ Brown NS, Smart A, Sharma V, Brinkmeier ML, Greenlee L, Camper SA, Jensen DR, Eckel RH, Krezel W, Chambon P, Haugen BR (juli 2000). "Thyroid hormone resistance and increased metabolic rate in the RXR-gamma-deficient mouse". The Journal of Clinical Investigation. 106 (1): 73–9. doi:10.1172/JCI9422. PMC 314362. PMID 10880050.
  16. ^ Nikiforova MN, Lynch RA, Biddinger PW, Alexander EK, Dorn GW, Tallini G, Kroll TG, Nikiforov YE (maj 2003). "RAS point mutations and PAX8-PPAR gamma rearrangement in thyroid tumors: evidence for distinct molecular pathways in thyroid follicular carcinoma". The Journal of Clinical Endocrinology and Metabolism. 88 (5): 2318–26. doi:10.1210/jc.2002-021907. PMID 12727991.
  17. ^ Abel ED, Boers ME, Pazos-Moura C, Moura E, Kaulbach H, Zakaria M, Lowell B, Radovick S, Liberman MC, Wondisford F (august 1999). "Divergent roles for thyroid hormone receptor beta isoforms in the endocrine axis and auditory system". The Journal of Clinical Investigation. 104 (3): 291–300. doi:10.1172/JCI6397. PMC 408418. PMID 10430610.
  18. ^ Ramachandran D, Wang Y, Schürmann P, Hülse F, Mao Q, Jentschke M, Böhmer G, Strauß HG, Hirchenhain C, Schmidmayr M, Müller F, Runnebaum I, Hein A, Koch M, Ruebner M, Beckmann MW, Fasching PA, Luyten A, Dürst M, Hillemanns P, Dörk T (Apr 27, 2021). "Association of genomic variants at PAX8 and PBX2 with cervical cancer risk". International Journal of Cancer. 149 (4): 893–900. doi:10.1002/ijc.33614. PMID 33905146 Provjerite vrijednost parametra |pmid= (pomoć).

Dopunska literatura uredi

Vanjski linkovi uredi

Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.