Protein 5 srodan C1q i tumorskom faktoru nekroze, znan i kao C1QTNF5, je protein koji je kod ljudi kodiran genom C1QTNF5.[5][6] The C1QTNF5 gene secreted and membrane-linked to a protein which is strongly expressed in retinal pigment epithelium cells.[7][8][9]

C1QTNF5
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4F3J, 4NN0

Identifikatori
AliasiC1QTNF5
Vanjski ID-jeviOMIM: 608752 MGI: 2385958 HomoloGene: 9227 GeneCards: C1QTNF5
Lokacija gena (čovjek)
Hromosom 11 (čovjek)
Hrom.Hromosom 11 (čovjek)[1]
Hromosom 11 (čovjek)
Genomska lokacija za C1QTNF5
Genomska lokacija za C1QTNF5
Bend11q23.3Početak119,338,942 bp[1]
Kraj119,340,940 bp[1]
Lokacija gena (miš)
Hromosom 9 (miš)
Hrom.Hromosom 9 (miš)[2]
Hromosom 9 (miš)
Genomska lokacija za C1QTNF5
Genomska lokacija za C1QTNF5
Bend9 A5.1|9 24.62 cMPočetak44,018,542 bp[2]
Kraj44,020,484 bp[2]
Ontologija gena
Molekularna funkcija vezivanje identičnih proteina
Ćelijska komponenta extracellular region
collagen
projekcija ćelije
membrana
lateral plasma membrane
apical plasma membrane
ćelijska membrana
transport vesicle
bicellular tight junction
Vanćelijsko
Biološki proces protein secretion
protein trimerization
inner ear development
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_015645
NM_001278431

NM_001040631
NM_001040632
NM_001190313
NM_001190319
NM_145613

RefSeq (bjelančevina)

NP_001265360
NP_056460

NP_001177243
NP_667337
NP_001035721
NP_001035722
NP_001177242

NP_001177248
NP_663588

Lokacija (UCSC)Chr 11: 119.34 – 119.34 MbChr 9: 44.02 – 44.02 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Aminokiselinska sekvenca uredi

Dužina polipeptidnog lanca je 243 aminokiseline, a molekulska težina 25.298 Da.[10]

1020304050
MRPLLVLLLLGLAAGSPPLDDNKIPSLCPGHPGLPGTPGHHGSQGLPGRD
GRDGRDGAPGAPGEKGEGGRPGLPGPRGDPGPRGEAGPAGPTGPAGECSV
PPRSAFSAKRSESRVPPPSDAPLPFDRVLVNEQGHYDAVTGKFTCQVPGV
YYFAVHATVYRASLQFDLVKNGESIASFFQFFGGWPKPASLSGGAMVRLE
PEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSPVFA

Struktura uredi

Struktura proteina 5 povezanog sa C1q faktorom nekroze tumora i C1QTNF5 koji se naziva i CTRP5[11] ima tri bitna domena. Prvi je jedan peptid koji se nalazi u N-terminalu, drugi je kolažni domenn, a treći domen je globularni komplement 1q (gC1q), u C-terminalnom domenu.[7][8][12][13][14] Pojedinačna mutacija S163R nalazi se u gC1q domenu što je glavni razlog za kasnopojavnu bolest degeneracije mrežnjače (L-ORD).[7][8][9][14] C1QTNF5 je dio porodice C1q. Međutim, postoji jedinstvena karakteristika strukture C1QTNF5 da ne posjeduje Ca2+ mjesto vezanja kao drugi članovi porodice C1q.[7]

Kristalna struktura uredi

Kristalnu strukturu C1QTNF5 odredili su Xiongying i Krzysztof i ona ima dvije karakteristike. Jedna je da struktura C1QTNF5 izgleda nema mjesto vezanja Ca2+ radi njegove stabilnosti. Također, potrebna je za funkciju članova porodice C1q. Druga značajka je da ima neobičnu sekvencu (F181, F182, G183, G184, W185, P186) koja generira hidrofobno polje. U ovom području, S163 i F182 grade H vezu, međutim, mutacija S163 će poremetiti H vezu.[7]

Funkcija uredi

Protein CTRP5 je član nadporodice C1q /faktora tumorske nekroze, koja pokazuje različite funkcije uključujući ćelijsku adheziju i kao komponente bazne membrane.[15]

Klinički značaj uredi

Mutacija u genu C1QTNF5 uzrokuje kasni početak degeneracije mrežnjače.[6] Preciznije, jedna misens mutacija (S163R) u kodiranom proteinu C1QTNF5 uzrokuje kasnu pojavu retinalne degeneracije (L-ORD).[5]

Reference uredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000223953 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000079592 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ a b Stanton CM, Borooah S, Drake C, Marsh JA, Campbell S, Lennon A, Soares DC, Vallabh NA, Sahni J, Cideciyan AV, Dhillon B, Vitart V, Jacobson SG, Wright AF, Hayward C (septembar 2017). "Novel pathogenic mutations in C1QTNF5 support a dominant negative disease mechanism in late-onset retinal degeneration". Scientific Reports. 7 (1): 12147. doi:10.1038/s41598-017-11898-3. PMC 5610255. PMID 28939808.
  6. ^ a b "Entrez Gene: C1QTNF5 C1q and tumor necrosis factor related protein 5".
  7. ^ a b c d e Tu X, Palczewski K (decembar 2012). "Crystal structure of the globular domain of C1QTNF5: Implications for late-onset retinal macular degeneration". Journal of Structural Biology. 180 (3): 439–46. doi:10.1016/j.jsb.2012.07.011. PMC 3496058. PMID 22892318.
  8. ^ a b c Stanton CM, Borooah S, Drake C, Marsh JA, Campbell S, Lennon A, Soares DC, Vallabh NA, Sahni J, Cideciyan AV, Dhillon B, Vitart V, Jacobson SG, Wright AF, Hayward C (septembar 2017). "Novel pathogenic mutations in C1QTNF5 support a dominant negative disease mechanism in late-onset retinal degeneration". Scientific Reports. 7 (1): 12147. doi:10.1038/s41598-017-11898-3. PMC 5610255. PMID 28939808.
  9. ^ a b Hayward C, Shu X, Cideciyan AV, Lennon A, Barran P, Zareparsi S, Sawyer L, Hendry G, Dhillon B, Milam AH, Luthert PJ, Swaroop A, Hastie ND, Jacobson SG, Wright AF (oktobar 2003). "Mutation in a short-chain collagen gene, CTRP5, results in extracellular deposit formation in late-onset retinal degeneration: a genetic model for age-related macular degeneration". Human Molecular Genetics. 12 (20): 2657–67. doi:10.1093/hmg/ddg289. PMID 12944416.
  10. ^ "UniProt, Q9BXJ0". Pristupljeno 19. 8. 2021.
  11. ^ Shu X, Tulloch B, Lennon A, Vlachantoni D, Zhou X, Hayward C, Wright AF (maj 2006). "Disease mechanisms in late-onset retinal macular degeneration associated with mutation in C1QTNF5". Human Molecular Genetics. 15 (10): 1680–9. doi:10.1093/hmg/ddl091. PMID 16600989.
  12. ^ Mandal MN, Vasireddy V, Reddy GB, Wang X, Moroi SE, Pattnaik BR, Hughes BA, Heckenlively JR, Hitchcock PF, Jablonski MM, Ayyagari R (decembar 2006). "CTRP5 is a membrane-associated and secretory protein in the RPE and ciliary body and the S163R mutation of CTRP5 impairs its secretion". Investigative Ophthalmology & Visual Science. 47 (12): 5505–13. doi:10.1167/iovs.06-0312. PMID 17122142.
  13. ^ Chavali VR, Khan NW, Cukras CA, Bartsch DU, Jablonski MM, Ayyagari R (maj 2011). "A CTRP5 gene S163R mutation knock-in mouse model for late-onset retinal degeneration". Human Molecular Genetics. 20 (10): 2000–14. doi:10.1093/hmg/ddr080. PMC 3080610. PMID 21349921.
  14. ^ a b Dinculescu A, Min SH, Dyka FM, Deng WT, Stupay RM, Chiodo V, Smith WC, Hauswirth WW (oktobar 2015). "Pathological Effects of Mutant C1QTNF5 (S163R) Expression in Murine Retinal Pigment Epithelium". Investigative Ophthalmology & Visual Science. 56 (11): 6971–80. doi:10.1167/iovs.15-17166. PMC 4627469. PMID 26513502.
  15. ^ Shapiro L, Scherer PE (mart 1998). "The crystal structure of a complement-1q family protein suggests an evolutionary link to tumor necrosis factor". Current Biology. 8 (6): 335–8. doi:10.1016/S0960-9822(98)70133-2. PMID 9512423. S2CID 14287212.

Dopunska literatura uredi

Vanjski linkovi uredi