Hox geni su grupa srodnih gena koji određuju osnovnu strukturu i orijentaciju životinja i biljaka.[1][2] 'Hox' je skraćenica od homeoboks.

Hox geni su kritični za pravilno postavljanje segmentnih struktura životinja tokom ranog embrionskog razvoja (npr. noge, antene i krila kod vinskih mušica roda Drosophila ili različita kičmenjaka, rebra kod ljudi).[3]

Jednostavan dijagram kolinearnosti

Hox geni su kompleks gena čiji se proteini vezuju za regulatorne regije ciljnih gena. Ciljni geni tada aktiviraju ili potiskuju ćelijske procese, kako bi usmjerili konačni razvoj organizma.[4][5]

Sekvenca hox gena uredi

Kod nekih organizama, posebno kičmenjaka, različiti hox geni su vrlo bliski jedan drugom na hromosomu u grupama ili klasterima.[8]

Redoslijed gena na hromosomu je isti kao i ekspresija gena u razvoju embriona. Prvi gen eksprimiran je u prednjem dijelu organizma u razvoju. Razlog za ovu kolinearnost još nije u potpunosti shvaćen. Gornji dijagram pokazuje odnos između gena i ekspresije proteina kod vinskih muha.

Biohemijska funkcija uredi

Proizvodi Hox gena su Hox proteini. Hox proteini su podskup transkripcionih faktora, koji su proteini koji su sposobni da se vežu za specifične nukleotidne sekvence na DNK zvane pojačivači putem kojih ili aktiviraju ili potiskuju stotine drugih gena. Isti Hox protein može djelovati kao represor na jednom genu i aktivator na drugom. Sposobnost Hox proteina da vežu DNK daje dio proteina koji se naziva homeodomenski nabor. Homeodomen je dud 60-aminokiselina DNK-vezujući domen (kodiran njegovom odgovarajućom sekvencom DNK od homeoboksa sa 180 baznih parova). Ova aminokiselinska sekvenca se savija u motiv "heliks-zavoj-heliks" (tj. homeodomenski nabor) koji je stabiliziran trećom spiralom. Konsenzusni polipeptidni lanac je prikazan ispod:[10] Hox proteini često djeluju u partnerstvu s kofaktorima, kao što su PBC i Meis proteini kodirani vrlo različitim tipovima homeoboksnih gena.[11]

           Heliks 1          Heliks 2         Heliks 3/4
        ______________    __________    _________________
RRRKRTAYTRYQLLELEKEFLFNRYLTRRRRIELAHSLNLTERHIKIWFQNRRMKWKKEN
....|....|....|....|....|....|....|....|....|....|....|....|
         10        20        30        40        50        60

Konzervacija uredi

 
Ekspresija Hox gena u tjelesnim segmentima različitih grupa Arthropoda. Hox geni 7, 8 i 9 odgovaraju u ovim grupama, ali su pomaknuti (heterohronija) za najviše tri segmenta. Segmenti sa maksilopedima imaju Hox gen 7. Fosilni trilobiti verovatno su imali tri tjelesna regiona, svaki sa jedinstvenom kombinacijom Hox gena.

Homeoboksni geni, a time i proteinski motivi homeodomena, nalaze se u većini eukariota. Hox geni, kao potklaster homeoboks gena, nastali su relativno nedavno u evoluciji unutar životinjskog carstva ili Metazoa. Unutar životinjskog carstva, Hox geni su prisutni širom Bilateralia (životinje sa jasnom osom od glave do repa), a također su pronađeni u Cnidaria, kao što je morske anemone. To implicira da su Hox geni nastali prije više od 550 miliona godina. U bilaterijama, Hox geni su često raspoređeni u genske klastere, iako postoje mnogi izuzeci gdje su geni razdvojeni hromosomskim preuređenjem.[12] Poređenje homeodomenskih sekvenci između Hox proteina često otkriva veću sličnost između vrsta nego unutar vrste; ovo zapažanje dovelo je do zaključka da su klasteri Hox gena evoluirali u ranoj fazi evolucije životinja iz jednog Hox gena, putem tandemske duplikacije i naknadne divergencije, te da je bio prisutan prototipski klaster Hox gena koji sadrži najmanje sedam različitih Hox gena u zajedničkom pretku svih bilateralnih životinja.[13]

U većini bilateralnih životinja, Hox geni su eksprimirani u raspoređenim domenima duž ose glave do repa embriona, što sugerira da je njihova uloga u određivanju položaja zajednička, drevna karakteristika.[14] Funkcionalno očuvanje Hox proteina može se demonstrirati činjenicom da muha može u velikoj mjeri funkcionirati s Hox proteinom kokoši umjesto svog vlastitog.[15] Dakle, uprkos tome što imamo posljednjeg zajedničkog pretka koji je živio prije više od 550 miliona godina,[16] verzija istog Hox gena za kokoši i muhu su dovoljno slične da ciljaju iste nizvodne gene kod muha.

Rasprostranjenje uredi

Proteinski motiv homeodomena vrlo je sličan kod većine životinja i biljaka. Osim toga, homeodomeni pojedinačnih hox proteina su slični kod mnogih vrsta.

Zbog toga se smatra da su klasteri hox gena evoluirali iz jednog hox gena putem tandemske duplikacije gena. Grupa hox gena sa najmanje sedam različitih hox gena je vjerovatno bila prisutna u zajedničkom pretku svih bilateralnih životinja.[17]

Ljudi uredi

Ljudi imaju ukupno 39 hox gena u klasterima na četiri hromosoma.

Također pogledajte uredi

Reference uredi

  1. ^ Dictionary.com – Hox gene [1]. Accessed March 31, 2011.
  2. ^ Jongmin Nam, Claude W. dePamphilis, Hong Ma, Masatoshi Nei. Antiquity and evolution of the MADS-Box gene family controlling flower development in plants. [2]
  3. ^ Gehring, Walter J. 1998. Master control genes in development and evolution. the homeobox story. Yale University Press, New Haven CT.
  4. ^ Lewis E.B. 1995. The bithorax complex: the first fifty years. Nobel Prize lecture. Repr. in Ringertz N. (ed) 1997. Nobel lectures, Physiology or Medicine. World Scientific, Singapore.
  5. ^ Lawrence P. 1992. The making of a fly. Blackwell, Oxford.
  6. ^ Carroll S.B. (1995). "Homeotic genes and the evolution of arthropods and chordates". Nature. 376 (6540): 479–85. Bibcode:1995Natur.376..479C. doi:10.1038/376479a0. PMID 7637779. S2CID 4230019.
  7. ^ Duncan I. 1987. The bithorax complex. Ann. Rev. Genetics 21, 285–319.
  8. ^ a b E.B. Lewis, 1992. Clusters of master control genes regulate the development of higher organisma. Journal of the American Medical Association 292 154–31.
  9. ^ Ryan J.F. et al 2007. Pre-bilaterian origins of the hox cluster and the hox code: evidence from the sea anemone, Nematostella vectensis. PLoS ONE 2, (1), e153. [3]
  10. ^ "Helix 1, Helix 2, Helix 3/4". csb.ki.se. Department of Biosciences and Nutrition, Karolinska Institute. Pristupljeno 9. 3. 2022.
  11. ^ Merabet S, Galliot B (2015). "The TALE face of Hox proteins in animal evolution". Frontiers in Genetics. 6: 267. doi:10.3389/fgene.2015.00267. PMC 4539518. PMID 26347770.
  12. ^ Ferrier DE, Minguillón C (2003). "Evolution of the Hox/ParaHox gene clusters". The International Journal of Developmental Biology. 47 (7–8): 605–611. PMID 14756336.
  13. ^ Krumlauf R (juli 1994). "Hox genes in vertebrate development". Cell. 78 (2): 191–201. doi:10.1016/0092-8674(94)90290-9. PMID 7913880. S2CID 39168197.
  14. ^ Gaunt SJ (2018). "Hox cluster genes and collinearities throughout the tree of animal life". The International Journal of Developmental Biology. 62 (11–12): 673–683. doi:10.1387/ijdb.180162sg. PMID 30604837.
  15. ^ Lutz B, Lu HC, Eichele G, Miller D, Kaufman TC (januar 1996). "Rescue of Drosophila labial null mutant by the chicken ortholog Hoxb-1 demonstrates that the function of Hox genes is phylogenetically conserved". Genes & Development. 10 (2): 176–184. doi:10.1101/gad.10.2.176. PMID 8566751.
  16. ^ Ayala FJ, Rzhetsky A, Ayala FJ (januar 1998). "Origin of the metazoan phyla: molecular clocks confirm paleontological estimates". Proceedings of the National Academy of Sciences of the United States of America. 95 (2): 606–611. Bibcode:1998PNAS...95..606J. doi:10.1073/pnas.95.2.606. PMC 18467. PMID 9435239.
  17. ^ McGinnis W. & R. Krumlauf (1992). "Homeobox genes and axial patterning". Cell. 68 (2): 283–302. doi:10.1016/0092-8674(92)90471-N. PMID 1346368. S2CID 27214031.