Haloacidni protein 2 sa dehalogenazolikim hidrolaznim domenom jest enzim koji je kod ljudi kodiran genom HDHD2.[5][6]

HDHD2
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

3HLT

Identifikatori
AliasiHDHD2
Vanjski ID-jeviMGI: 1924237 HomoloGene: 12667 GeneCards: HDHD2
Lokacija gena (čovjek)
Hromosom 18 (čovjek)
Hrom.Hromosom 18 (čovjek)[1]
Hromosom 18 (čovjek)
Genomska lokacija za HDHD2
Genomska lokacija za HDHD2
Bend18q21.1Početak47,107,408 bp[1]
Kraj47,150,500 bp[1]
Lokacija gena (miš)
Hromosom 18 (miš)
Hrom.Hromosom 18 (miš)[2]
Hromosom 18 (miš)
Genomska lokacija za HDHD2
Genomska lokacija za HDHD2
Bend18|18 E3Početak77,031,788 bp[2]
Kraj77,063,003 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija metal ion binding
enzyme binding
GO:0098519, GO:0098518 phosphatase activity
GO:0001948, GO:0016582 protein binding
Ćelijska komponenta Egzosom
Biološki proces GO:0098501, GO:0098502, GO:0006286 Defosforilacija
GO:0022610 biološki proces
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_032124
NM_001318765

NM_001039201
NM_001039202
NM_029826
NM_001361227

RefSeq (bjelančevina)

NP_001305694
NP_115500

NP_001034290
NP_001034291
NP_084102
NP_001348156

Lokacija (UCSC)Chr 18: 47.11 – 47.15 MbChr 18: 77.03 – 77.06 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Dužina polipeptidnog lanca iznosi 259 aminokiselina, a molekulska masa je 28.536.[7]

Aminokiselinska sekvenca

Simboli
1020304050
MAACRALKAVLVDLSGTLHIEDAAVPGAQEALKRLRGASVIIRFVTNTTK
ESKQDLLERLRKLEFDISEDEIFTSLTAARSLLERKQVRPMLLVDDRALP
DFKGIQTSDPNAVVMGLAPEHFHYQILNQAFRLLLDGAPLIAIHKARYYK
RKDGLALGPGPFVTALEYATDTKATVVGKPEKTFFLEALRGTGCEPEEAV
MIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPPYLTCESFPHA
VDHILQHLL

Reference uredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000167220 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000025421 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Bocher M, Blocker H, Bauersachs S, Blum H, Lauber J, Dusterhoft A, Beyer A, Kohrer K, Strack N, Mewes HW, Ottenwalder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A (Mar 2001). "Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs". Genome Res. 11 (3): 422–35. doi:10.1101/gr.GR1547R. PMC 311072. PMID 11230166.
  6. ^ "Entrez Gene: HDHD2 haloacid dehalogenase-like hydrolase domain containing 2".
  7. ^ "UniProt, Q9H0R4". Pristupljeno 12. 9. 2017.

Dopunska literatura uredi