ZGPAT

(Preusmjereno sa ZIP)

CCCH-tip cinkovog prsta sa G-parčetom domen-sadržavajućeg proteina je protein koji je kod ljudi kodiran genom ZGPAT.[5][6]

ZGPAT
Dostupne strukture
PDBPretraga ortologa: PDBe RCSB
Spisak PDB ID kodova

4II1

Identifikatori
AliasiZGPAT
Vanjski ID-jeviMGI: 2449939 HomoloGene: 41874 GeneCards: ZGPAT
Lokacija gena (čovjek)
Hromosom 20 (čovjek)
Hrom.Hromosom 20 (čovjek)[1]
Hromosom 20 (čovjek)
Genomska lokacija za ZGPAT
Genomska lokacija za ZGPAT
Bend20q13.33Početak63,707,465 bp[1]
Kraj63,736,142 bp[1]
Lokacija gena (miš)
Hromosom 2 (miš)
Hrom.Hromosom 2 (miš)[2]
Hromosom 2 (miš)
Genomska lokacija za ZGPAT
Genomska lokacija za ZGPAT
Bend2|2 H4Početak181,364,928 bp[2]
Kraj181,383,628 bp[2]
Obrazac RNK ekspresije
PBB GE ZGPAT 57539 at fs.png

PBB GE ZGPAT 221848 at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija GO:0001131, GO:0001151, GO:0001130, GO:0001204 DNA-binding transcription factor activity
GO:0000980 RNA polymerase II cis-regulatory region sequence-specific DNA binding
sequence-specific DNA binding
DNA binding
GO:0001078, GO:0001214, GO:0001206 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0001948 protein binding
metal ion binding
nucleic acid binding
GO:0001200, GO:0001133, GO:0001201 DNA-binding transcription factor activity, RNA polymerase II-specific
Ćelijska komponenta Jedro
Ćelijska membrana
Biološki proces negative regulation of epidermal growth factor-activated receptor activity
negative regulation of transcription, DNA-templated
regulation of transcription, DNA-templated
negative regulation of transcription by RNA polymerase II
transcription, DNA-templated
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)
NM_181485
NM_001083113
NM_001195653
NM_001195654
NM_032527

NM_181484

NM_001048148
NM_144894

RefSeq (bjelančevina)

NP_001076582
NP_001182582
NP_001182583
NP_115916
NP_852150

NP_001041613
NP_659143

Lokacija (UCSC)Chr 20: 63.71 – 63.74 MbChr 2: 181.36 – 181.38 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

OntologijaUredi

Molekulska funkcija
  • GO: 0001131, GO: 0001151, GO: 0001130, GO: 0001204
  • Aktivnost DNK-vezujućeg transkripcijskog faktora
  • GO: 0000980 RNA polimeraza II za specifično za sekvencu cis-regulatorno područje vezivanja DNK
  • vezanje DNK specifično za sekvence
  • Vezanje DNK
  • GO: 0001078, GO: 0001214, GO: 0001206 Represorska aktivnost transkripcije koja veže DNK, specifična za RNK polimerazu II
  • GO: 0001948 vezanje za proteine
  • vezanje metalnih iona
  • vezanje nukleinske kiseline
  • GO: 0001200, GO: 0001133, GO: 0001201 aktivnost transkripcionog faktora koji veže DNK, specifična za RNA polimerazu II
Ćelijska komponenta
Biološki proces
  • negativna regulacija aktivnosti receptora aktiviranog epidermnim faktorom rasta
  • negativna regulacija transkripcije, sa predloškom DNK
  • regulacija transkripcije, sa predloškom DNK
  • negativna regulacija transkripcije RNK-polimerazom II
  • transkripcija, DNK predložak
Izvori: Amigo / QuickGO

Aminokiselinska sekvencaUredi

Simboli
1020304050
MDEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELT
EASLVSVRKSSLLAALDEERPGRQEDAEYQAFREAITEAVEAPAAARGSG
SETVPKAEAGPESAAGGQEEEEGEDEEELSGTKVSAPYYSSWGTLEYHNA
MVVGTEEAEDGSAGVRVLYLYPTHKSLKPCPFFLEGKCRFKENCRFSHGQ
VVSLDELRPFQDPDLSSLQAGSACLAKHQDGLWHAARITDVDNGYYTVKF
DSLLLREAVVEGDGILPPLRTEATESDSDSDGTGDSSYARVVGSDAVDSA
QSSALCPSLAVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGK
GLGRHAEGRVEPIHAVVLPRGKSLDQCVETLQKQTRVGKAGTNKPPRCRG
RGARPGGRPAPRNVFDFLNEKLQGQAPGALEAGAAPAGRRSKDMYHASKS
AKRALSLRLFQTEEKIERTQRDIRSIQEALARNAGRHSVASAQLQEKLAG
AQRQLGQLRAQEAGLQQEQRKADTHKKMTEF

ReferenceUredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000197114 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000027582 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Ordway JM, Bedell JA, Citek RW, Nunberg A, Garrido A, Kendall R, Stevens JR, Cao D, Doerge RW, Korshunova Y, Holemon H, McPherson JD, Lakey N, Leon J, Martienssen RA, Jeddeloh JA (Nov 2006). "Comprehensive DNA methylation profiling in a human cancer genome identifies novel epigenetic targets". Carcinogenesis. 27 (12): 2409–23. doi:10.1093/carcin/bgl161. PMID 16952911.
  6. ^ "Entrez Gene: ZGPAT zinc finger, CCCH-type with G patch domain".

Dopunska literaturaUredi