CDK5 i ABL1 enzimski supstrat 1 jest protein koji je kod ljudi kodiran genom CABLES1.[5][6]

CABLES1
Identifikatori
AliasiCABLES1
Vanjski ID-jeviOMIM: 609194 MGI: 1927065 HomoloGene: 11097 GeneCards: CABLES1
Lokacija gena (čovjek)
Hromosom 18 (čovjek)
Hrom.Hromosom 18 (čovjek)[1]
Hromosom 18 (čovjek)
Genomska lokacija za CABLES1
Genomska lokacija za CABLES1
Bend18q11.2Početak23,134,564 bp[1]
Kraj23,260,470 bp[1]
Lokacija gena (miš)
Hromosom 18 (miš)
Hrom.Hromosom 18 (miš)[2]
Hromosom 18 (miš)
Genomska lokacija za CABLES1
Genomska lokacija za CABLES1
Bend18|18 A1Početak11,972,277 bp[2]
Kraj12,078,687 bp[2]
Ontologija gena
Molekularna funkcija GO:0001948, GO:0016582 protein binding
Ćelijska komponenta citoplazma
citosol
Jedro
Biološki proces Ćelijski ciklus
regulation of cell cycle
Ćelijska dioba
nervous system development
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001100619
NM_001256438
NM_138375

NM_001146287
NM_022021

RefSeq (bjelančevina)

NP_001094089
NP_001243367
NP_612384

NP_001139759
NP_071304

Lokacija (UCSC)Chr 18: 23.13 – 23.26 MbChr 18: 11.97 – 12.08 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Dužina polipeptidnog lanca je 633 aminokiseline, a molekulska masa — 67.599[7]. CABLES1 je ciklin-ovisna kinaza (CDK)-vezujući protein koji ima ulogu u proliferaciji i/ili diferencijaciji ćelija (prema: OMIM.[6] To je gen za supresiju tumora koji gubljenjem (mutacijama, nokautom, nokdaunom ili inaktivacijom) može dovesti do kolorektumskog karcinoma CRC.

Aminokiselinska sekvenca uredi

Simboli
1020304050
MAAAAAAATTAACSSGSAGTDAAGASGLQQPPPQPQPQPAAAAPAQPPPE
PPRKPRMDPRRRQAALSFLTNISLDGRLPPQDAEWGGGEEGGAAKPGAGG
ACGARTRFSLLAAAERGGCIALAAPGTPAAGLAAGSGPCLPQPSSLPPLI
PGGHATVSGPGVARGFASPLGAGRASGEQWQPPRPAPLAACAQLQLLDGS
GAAGQEELEEDDAFISVQVPAAAFLGSGTPGSGSGSRGRLNSFTQGILPI
AFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEE
NAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSI
FSVLPYRDSTQVGDLKLDGGRQSTGAVSLKEIIGLEGVELGADGKTVSYT
QFLLPTNAFGARRNTIDSTSSFSQFRNLSHRSLSIGRASGTQGSLDTGSD
LGDFMDYDPNLLDDPQWPCGKHKRVLIFPSYMTTVIDYVKPSDLKKDMNE
TFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLAL
KGKLNKQNRKLCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRREL
IAFEFPVLVALEFALHLPEHEVMPHYRRLVQSS

Reference uredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000134508 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000040957 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Strausberg RL, Feingold EA, Grouse LH, Derge JG, Klausner RD, Collins FS, Wagner L, Shenmen CM, Schuler GD, Altschul SF, Zeeberg B, Buetow KH, Schaefer CF, Bhat NK, Hopkins RF, Jordan H, Moore T, Max SI, Wang J, Hsieh F, Diatchenko L, Marusina K, Farmer AA, Rubin GM, Hong L, Stapleton M, Soares MB, Bonaldo MF, Casavant TL, Scheetz TE, Brownstein MJ, Usdin TB, Toshiyuki S, Carninci P, Prange C, Raha SS, Loquellano NA, Peters GJ, Abramson RD, Mullahy SJ, Bosak SA, McEwan PJ, McKernan KJ, Malek JA, Gunaratne PH, Richards S, Worley KC, Hale S, Garcia AM, Gay LJ, Hulyk SW, Villalon DK, Muzny DM, Sodergren EJ, Lu X, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madan A, Young AC, Shevchenko Y, Bouffard GG, Blakesley RW, Touchman JW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Krzywinski MI, Skalska U, Smailus DE, Schnerch A, Schein JE, Jones SJ, Marra MA (Dec 2002). "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences". Proc Natl Acad Sci U S A. 99 (26): 16899–903. doi:10.1073/pnas.242603899. PMC 139241. PMID 12477932.
  6. ^ a b "Entrez Gene: CABLES1 Cdk5 and Abl enzyme substrate 1".
  7. ^ "UniProt, Q8TDN4" (jezik: англ.). Pristupljeno 12. 9. 2017.CS1 održavanje: nepoznati jezik (link)

Vanjski linkovi uredi

Dopunska literatura uredi