Sintaksin-8 jest protein koji je kod ljudi kodiran genom STX8 sa hromosoma 17.[5][6][7] Sintaksin-8 direktno je u interakciji sa HECTd3 i ima sličnu subćelijsku lokalizaciju.[8] Pokazalo se da ovaj protein formira SNARE kompleks sa sintaksinom-7, vti1b i endobrevinom. Oni funkcionišu kao mehanizam za homotipsku fuziju kasnih endosoma.[9]

STX8
Protein STX8 PDB 1gl2.png
Identifikatori
AliasiSTX8
Vanjski ID-jeviOMIM: 604203 MGI: 1890156 HomoloGene: 37973 GeneCards: STX8
Lokacija gena (čovjek)
Hromosom 17 (čovjek)
Hrom.Hromosom 17 (čovjek)[1]
Hromosom 17 (čovjek)
Genomska lokacija za STX8
Genomska lokacija za STX8
Bend17p13.1Početak9,250,471 bp[1]
Kraj9,576,591 bp[1]
Lokacija gena (miš)
Hromosom 11 (miš)
Hrom.Hromosom 11 (miš)[2]
Hromosom 11 (miš)
Genomska lokacija za STX8
Genomska lokacija za STX8
Bend11|11 B3Početak67,857,019 bp[2]
Kraj68,097,974 bp[2]
Obrazac RNK ekspresije
PBB GE STX8 gnf1h09416 s at fs.png

PBB GE STX8 204690 at fs.png

PBB GE STX8 gnf1h09415 s at fs.png
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija SNAP receptor activity
GO:0001948, GO:0016582 protein binding
chloride channel inhibitor activity
syntaxin binding
ubiquitin protein ligase binding
SNARE binding
Ćelijska komponenta integral component of membrane
reciklirajući endosom
Vezikula
endozom
late endosome
membrana
late endosome membrane
integral component of plasma membrane
lysosomal membrane
trans-Golđijeva mreža
early endosome
Endoplazmatski retikulum
perinuklearno područje citoplazme
citosol
SNARE complex
phagocytic vesicle
Endomembranski sistem
Biološki proces endosome to lysosome transport
vesicle docking
early endosome to late endosome transport
intracellular protein transport
vesicle-mediated transport
regulation of protein localization to plasma membrane
Fuzija vezikula
cellular response to interferon-gamma
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_004853

NM_018768
NM_001356314
NM_001361350
NM_001361351
NM_001361352

RefSeq (bjelančevina)

NP_004844

NP_061238
NP_001343243
NP_001348279
NP_001348280
NP_001348281

Lokacija (UCSC)Chr 17: 9.25 – 9.58 MbChr 11: 67.86 – 68.1 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Aminokiselinska sekvencaUredi

Dužina polipeptidnog lanca je 236 aminokiselina, a molekulska težina 26.907 Da.[7]

1020304050
MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQN
LKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNE
GAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQE
QDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNE
TRRVNMVDRKSASCGMIMVILLLLVAIVVVAVWPTN

Modelni organizmiUredi

U proučavanju funkcije STX8 korišteni su modelni organizam. Uslovna nokaut-mišja linija zvana Stx8tm2a(EUCOMM)Wtsi[10][11] generirana je kao dio programa Međunarodnog konzorcija za nokaut-miševe — projekta mutageneze visoke propusnosti za generiranje i distribuciju životinjskih modela bolesti zainteresiranim naučnicima — na Institutu Wellcome Trust Sanger.[12][13][14] Mužjaci i ženke podvrgnuti su standardiziranom fenotipskom pregledu, kako bi se utvrdili efekti delecija.[15][16] Provedena su 24 testa na homozigotnim mutantnim odraslim miševima, ali nisu uočene nikakve značajne abnormalnosti.[15]

Stx8 fenotip nokaut-miševa
Svojstvo Fenotip
Vijabilnost homozigota Normal
Tjelesna težina Normal
Anksioznost otvorenog polja Normal
Neurološka procjena Normal
Snaga stiska Normal
Test vruće ploče Normal
Dismorfologija Normal
Indirektna kalorimetrija Normal
Test tolerancije glukoze Normal
Slušni odgovor moždanog stabla Normal
DEXA Normal
Radiografija Normal
Tjelesna temperatura Normal
Morfologija oka Normal
Klinička hemija Normal
Hematologija Normal
Limfociti periferne krvi Normal
Mikronukleus test Normal
Težina srca Normal
Histopatologija kože Normal
Histopatologija mozga Normal
Histopatologija oka Normal
Salmonella infekcija Normal[17]
Citrobacter infekcija Normal[18]
Svi testovi i analize su prema:[15][19]

InterakcijeUredi

Pokazalo se da STX8 međudjeluje sa membranskim proteinom 8 povezanim sa vezikulama,[20] VTI1B[21][22] i STX7.[20]

ReferenceUredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000170310 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000020903 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Steegmaier M, Yang B, Yoo JS, Huang B, Shen M, Yu S, Luo Y, Scheller RH (Dec 1998). "Three novel proteins of the syntaxin/SNAP-25 family". The Journal of Biological Chemistry. 273 (51): 34171–9. doi:10.1074/jbc.273.51.34171. PMID 9852078.
  6. ^ Thoreau V, Bergès T, Callebaut I, Guillier-Gencik Z, Gressin L, Bernheim A, Karst F, Mornon JP, Kitzis A, Chomel JC (Apr 1999). "Molecular cloning, expression analysis, and chromosomal localization of human syntaxin 8 (STX8)". Biochemical and Biophysical Research Communications. 257 (2): 577–83. doi:10.1006/bbrc.1999.0503. PMID 10198254.
  7. ^ a b "Entrez Gene: STX8 syntaxin 8".
  8. ^ Zhang L, Kang L, Bond W, Zhang N (Feb 2009). "Interaction between syntaxin 8 and HECTd3, a HECT domain ligase". Cellular and Molecular Neurobiology. 29 (1): 115–21. doi:10.1007/s10571-008-9303-0. PMID 18821010. S2CID 23216243.
  9. ^ Kasai K, Suga K, Izumi T, Akagawa K (October 2008). "Syntaxin 8 has two functionally distinct di-leucine-based motifs". Cellular & Molecular Biology Letters. 13 (1): 144–54. doi:10.2478/s11658-007-0043-9. PMC 6275627. PMID 17965969.
  10. ^ "International Knockout Mouse Consortium".
  11. ^ "Mouse Genome Informatics".
  12. ^ Skarnes WC, Rosen B, West AP, Koutsourakis M, Bushell W, Iyer V, Mujica AO, Thomas M, Harrow J, Cox T, Jackson D, Severin J, Biggs P, Fu J, Nefedov M, de Jong PJ, Stewart AF, Bradley A (Jun 2011). "A conditional knockout resource for the genome-wide study of mouse gene function". Nature. 474 (7351): 337–42. doi:10.1038/nature10163. PMC 3572410. PMID 21677750.
  13. ^ Dolgin E (Jun 2011). "Mouse library set to be knockout". Nature. 474 (7351): 262–3. doi:10.1038/474262a. PMID 21677718.
  14. ^ Collins FS, Rossant J, Wurst W (Jan 2007). "A mouse for all reasons". Cell. 128 (1): 9–13. doi:10.1016/j.cell.2006.12.018. PMID 17218247. S2CID 18872015.
  15. ^ a b c Gerdin AK (2010). "The Sanger Mouse Genetics Programme: High throughput characterisation of knockout mice". Acta Ophthalmologica. 88 (S248). doi:10.1111/j.1755-3768.2010.4142.x. S2CID 85911512.
  16. ^ van der Weyden L, White JK, Adams DJ, Logan DW (2011). "The mouse genetics toolkit: revealing function and mechanism". Genome Biology. 12 (6): 224. doi:10.1186/gb-2011-12-6-224. PMC 3218837. PMID 21722353.
  17. ^ "Salmonella infection data for Stx8". Wellcome Trust Sanger Institute.
  18. ^ "Citrobacter infection data for Stx8". Wellcome Trust Sanger Institute.
  19. ^ Mouse Resources Portal, Wellcome Trust Sanger Institute.
  20. ^ a b Antonin W, Holroyd C, Fasshauer D, Pabst S, Von Mollard GF, Jahn R (Dec 2000). "A SNARE complex mediating fusion of late endosomes defines conserved properties of SNARE structure and function". The EMBO Journal. 19 (23): 6453–64. doi:10.1093/emboj/19.23.6453. PMC 305878. PMID 11101518.
  21. ^ Rual JF, Venkatesan K, Hao T, Hirozane-Kishikawa T, Dricot A, Li N, Berriz GF, Gibbons FD, Dreze M, Ayivi-Guedehoussou N, Klitgord N, Simon C, Boxem M, Milstein S, Rosenberg J, Goldberg DS, Zhang LV, Wong SL, Franklin G, Li S, Albala JS, Lim J, Fraughton C, Llamosas E, Cevik S, Bex C, Lamesch P, Sikorski RS, Vandenhaute J, Zoghbi HY, Smolyar A, Bosak S, Sequerra R, Doucette-Stamm L, Cusick ME, Hill DE, Roth FP, Vidal M (Oct 2005). "Towards a proteome-scale map of the human protein-protein interaction network". Nature. 437 (7062): 1173–8. doi:10.1038/nature04209. PMID 16189514. S2CID 4427026.
  22. ^ Subramaniam VN, Loh E, Horstmann H, Habermann A, Xu Y, Coe J, Griffiths G, Hong W (Mar 2000). "Preferential association of syntaxin 8 with the early endosome". Journal of Cell Science. 113 ( Pt 6) (6): 997–1008. PMID 10683148.

Dopuznska literaturaUredi

Vanjski linkoviUredi