STX1A

(Preusmjereno sa Sintaksin 1A)

Sintaksin-1A jest protein koji je kod ljudi kodiran genom STX1A sa hromosoma 7.[5]

STX1A
Identifikatori
AliasiSTX1A
Vanjski ID-jeviOMIM: 186590 MGI: 109355 HomoloGene: 37941 GeneCards: STX1A
Lokacija gena (čovjek)
Hromosom 7 (čovjek)
Hrom.Hromosom 7 (čovjek)[1]
Hromosom 7 (čovjek)
Genomska lokacija za STX1A
Genomska lokacija za STX1A
Bend7q11.23Početak73,699,206 bp[1]
Kraj73,719,672 bp[1]
Lokacija gena (miš)
Hromosom 5 (miš)
Hrom.Hromosom 5 (miš)[2]
Hromosom 5 (miš)
Genomska lokacija za STX1A
Genomska lokacija za STX1A
Bend5|5 G2Početak135,052,336 bp[2]
Kraj135,079,954 bp[2]
Obrazac RNK ekspresije
Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija calcium channel inhibitor activity
transmembrane transporter binding
protein N-terminus binding
SNAP receptor activity
kinase binding
chloride channel inhibitor activity
protein heterodimerization activity
SNARE binding
GO:0001948, GO:0016582 vezivanje za proteine
myosin binding
protein domain specific binding
protein-macromolecule adaptor activity
myosin head/neck binding
ATP-dependent protein binding
calcium-dependent protein binding
Ćelijska komponenta integral component of membrane
citosol
membrana
Sinapsna vezikula
synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex
voltage-gated potassium channel complex
ćelijska membrana
sinapsa
synaptic vesicle membrane
secretory granule
extracellular region
synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex
međućelijske veze
SNARE complex
intracellular organelle
neuron projection
synaptobrevin 2-SNAP-25-syntaxin-1a complex
actomyosin
GO:0016023 citoplazmatska vezikula
presynaptic membrane
GO:0097483, GO:0097481 postsynaptic density
presynaptic active zone membrane
Jedarna membrana
integral component of plasma membrane
Akson
GO:0009327 makromolekulani kompleks
Akrozom
integral component of synaptic vesicle membrane
glutamatergic synapse
integral component of presynaptic membrane
Endomembranski sistem
intracellular anatomical structure
Biološki proces Egzocitoza
positive regulation of norepinephrine secretion
synaptic vesicle docking
secretion by cell
regulation of insulin secretion
positive regulation of catecholamine secretion
positive regulation of neurotransmitter secretion
positive regulation of calcium ion-dependent exocytosis
regulation of exocytosis
response to gravity
vesicle docking
positive regulation of excitatory postsynaptic potential
positive regulation of exocytosis
intracellular protein transport
neurotransmitter transport
vesicle-mediated transport
calcium-ion regulated exocytosis
regulation of synaptic vesicle priming
protein localization to membrane
modulation of excitatory postsynaptic potential
synaptic vesicle fusion to presynaptic active zone membrane
SNARE complex assembly
cytokine-mediated signaling pathway
synaptic vesicle exocytosis
Fuzija vezikula
GO:0010554 neurotransmitter secretion
glutamate secretion
protein sumoylation
insulin secretion
regulated exocytosis
hormone secretion
synaptic vesicle endocytosis
membrane fusion
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001165903
NM_004603

NM_016801
NM_001359179

RefSeq (bjelančevina)

NP_001159375
NP_004594
NP_004594.1

NP_058081
NP_001346108

Lokacija (UCSC)Chr 7: 73.7 – 73.72 MbChr 5: 135.05 – 135.08 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Aminokiselinska sekvenca uredi

Dužina polipeptidnog lanca je 288 aminokiselina, a molekulska težina 33.023 Da [6]

1020304050
MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAEN
VEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSI
EQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQ
RQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHS
EIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSD
TKKAVKYQSKARRKKIMIIICCVILGIVIASTVGGIFA

Funkcija uredi

Sinapsne vezikule skladište neurotransmiter koji se oslobađa tokom kalcijem regulisane egzocitoze. Specifičnost oslobađanja neurotransmitera zahteva lokalizaciju sinapsnih vezikula i kalcijskih kanala u aktivnu presinapsnu zonu. Sintaksini funkcionišu u ovom procesu fuzije vezikula.

Sintaksin-1A je član natšprodice sintaksin. Sintaksini su proteini specifični za nervni sistem uključeni u spajanje sinapsnih vezikula sa presinapsnom plazmamembranom. Sintaksini posjeduju jedan C-terminalni transmembranski domen, SNARE (Soluble NSF N-etilmaleimid-sensitive fuzion protein)-Attachment protein Receptor) domen (poznat kao H3), i N-terminalni regulatorni domen (Habc). Sintaksini se vezuju za sinaptotagmin na način ovisan o kalciju i stupaju u interakciju sa naponskim zavisnim kalcijevim i kalijevim kanalima preko C-terminalnog H3 domena. Sintaksin-1A je ključni protein u regulaciji ionskih kanala i sinapsnoj egzocitozi.[7]

Klinički značaj uredi

Sintaksini služe kao supstrat za botulinumski neurotoksin tipa C, metaloproteazu koja blokira egzocitozu i ima visok afinitet za molekulski kompleks koji uključuje alfa-latrotoksinski receptor koji proizvodi eksplozivnu egzocitozu.[8]

Nivo ekspresije STX1A je u direktnoj korelaciji sa inteligencijom u Williamsovom sindromu.[9]

Interaktivna mapa puta uredi

Šablon:NicotineDopaminergicActivity WP1602

Interakcije uredi

Pokazalo se da STX1A reaguje sa:

Također pogledajte uredi

Reference uredi

  1. ^ a b c GRCh38: Ensembl release 89: ENSG00000106089 - Ensembl, maj 2017
  2. ^ a b c GRCm38: Ensembl release 89: ENSMUSG00000007207 - Ensembl, maj 2017
  3. ^ "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. ^ "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. ^ Bennett MK, Calakos N, Scheller RH (juli 1992). "Syntaxin: a synaptic protein implicated in docking of synaptic vesicles at presynaptic active zones". Science. 257 (5067): 255–9. Bibcode:1992Sci...257..255B. doi:10.1126/science.1321498. PMID 1321498.
  6. ^ "UniProt, Q16623" (jezik: engleski). Pristupljeno 12. 4. 2022.
  7. ^ "Entrez Gene: STX1A syntaxin 1A (brain)".
  8. ^ Zhang R, Maksymowych AB, Simpson LL (juli 1995). "Cloning and sequence analysis of a cDNA encoding human syntaxin 1A, a polypeptide essential for exocytosis". Gene. 159 (2): 293–4. doi:10.1016/0378-1119(95)00152-V. PMID 7622072.
  9. ^ Gao MC, Bellugi U, Dai L, Mills DL, Sobel EM, Lange K, Korenberg JR (2010). Toland AE (ured.). "Intelligence in Williams Syndrome is related to STX1A, which encodes a component of the presynaptic SNARE complex". PLOS ONE. 5 (4): e10292. Bibcode:2010PLoSO...510292G. doi:10.1371/journal.pone.0010292. PMC 2858212. PMID 20422020.
  10. ^ a b c d Dulubova I, Sugita S, Hill S, Hosaka M, Fernandez I, Südhof TC, Rizo J (august 1999). "A conformational switch in syntaxin during exocytosis: role of munc18". The EMBO Journal. 18 (16): 4372–82. doi:10.1093/emboj/18.16.4372. PMC 1171512. PMID 10449403.
  11. ^ a b c Chen X, Tomchick DR, Kovrigin E, Araç D, Machius M, Südhof TC, Rizo J (januar 2002). "Three-dimensional structure of the complexin/SNARE complex". Neuron. 33 (3): 397–409. doi:10.1016/S0896-6273(02)00583-4. PMID 11832227. S2CID 17878965.
  12. ^ Hu K, Carroll J, Rickman C, Davletov B (novembar 2002). "Action of complexin on SNARE complex". The Journal of Biological Chemistry. 277 (44): 41652–6. doi:10.1074/jbc.M205044200. PMID 12200427.
  13. ^ Naren AP, Nelson DJ, Xie W, Jovov B, Pevsner J, Bennett MK, Benos DJ, Quick MW, Kirk KL (novembar 1997). "Regulation of CFTR chloride channels by syntaxin and Munc18 isoforms". Nature. 390 (6657): 302–5. Bibcode:1997Natur.390..302N. doi:10.1038/36882. PMID 9384384. S2CID 4395005.
  14. ^ Cormet-Boyaka E, Di A, Chang SY, Naren AP, Tousson A, Nelson DJ, Kirk KL (septembar 2002). "CFTR chloride channels are regulated by a SNAP-23/syntaxin 1A complex". Proceedings of the National Academy of Sciences of the United States of America. 99 (19): 12477–82. Bibcode:2002PNAS...9912477C. doi:10.1073/pnas.192203899. PMC 129470. PMID 12209004.
  15. ^ a b c d McMahon HT, Missler M, Li C, Südhof TC (oktobar 1995). "Complexins: cytosolic proteins that regulate SNAP receptor function". Cell. 83 (1): 111–9. doi:10.1016/0092-8674(95)90239-2. PMID 7553862. S2CID 675343.
  16. ^ Hanson PI, Otto H, Barton N, Jahn R (juli 1995). "The N-ethylmaleimide-sensitive fusion protein and alpha-SNAP induce a conformational change in syntaxin". The Journal of Biological Chemistry. 270 (28): 16955–61. doi:10.1074/jbc.270.28.16955. PMID 7622514.
  17. ^ Chin LS, Vavalle JP, Li L (septembar 2002). "Staring, a novel E3 ubiquitin-protein ligase that targets syntaxin 1 for degradation". The Journal of Biological Chemistry. 277 (38): 35071–9. doi:10.1074/jbc.M203300200. PMID 12121982.
  18. ^ Berdiev BK, Jovov B, Tucker WC, Naren AP, Fuller CM, Chapman ER, Benos DJ (juni 2004). "ENaC subunit-subunit interactions and inhibition by syntaxin 1A". American Journal of Physiology. Renal Physiology. 286 (6): F1100–6. doi:10.1152/ajprenal.00344.2003. PMID 14996668.
  19. ^ Beckman ML, Bernstein EM, Quick MW (august 1998). "Protein kinase C regulates the interaction between a GABA transporter and syntaxin 1A". The Journal of Neuroscience. 18 (16): 6103–12. doi:10.1523/JNEUROSCI.18-16-06103.1998. PMC 6793212. PMID 9698305.
  20. ^ Quick MW (april 2002). "Substrates regulate gamma-aminobutyric acid transporters in a syntaxin 1A-dependent manner". Proceedings of the National Academy of Sciences of the United States of America. 99 (8): 5686–91. Bibcode:2002PNAS...99.5686Q. doi:10.1073/pnas.082712899. PMC 122832. PMID 11960023.
  21. ^ Deken SL, Beckman ML, Boos L, Quick MW (oktobar 2000). "Transport rates of GABA transporters: regulation by the N-terminal domain and syntaxin 1A". Nature Neuroscience. 3 (10): 998–1003. doi:10.1038/79939. PMID 11017172. S2CID 11312913.
  22. ^ Stelzl U, Worm U, Lalowski M, Haenig C, Brembeck FH, Goehler H, Stroedicke M, Zenkner M, Schoenherr A, Koeppen S, Timm J, Mintzlaff S, Abraham C, Bock N, Kietzmann S, Goedde A, Toksöz E, Droege A, Krobitsch S, Korn B, Birchmeier W, Lehrach H, Wanker EE (septembar 2005). "A human protein-protein interaction network: a resource for annotating the proteome". Cell. 122 (6): 957–68. doi:10.1016/j.cell.2005.08.029. hdl:11858/00-001M-0000-0010-8592-0. PMID 16169070. S2CID 8235923.
  23. ^ a b Hata Y, Südhof TC (juni 1995). "A novel ubiquitous form of Munc-18 interacts with multiple syntaxins. Use of the yeast two-hybrid system to study interactions between proteins involved in membrane traffic". The Journal of Biological Chemistry. 270 (22): 13022–8. doi:10.1074/jbc.270.22.13022. PMID 7768895.
  24. ^ Gonelle-Gispert C, Molinete M, Halban PA, Sadoul K (septembar 2000). "Membrane localization and biological activity of SNAP-25 cysteine mutants in insulin-secreting cells". Journal of Cell Science. 113 ( Pt 18) (18): 3197–205. doi:10.1242/jcs.113.18.3197. PMID 10954418.
  25. ^ Ilardi JM, Mochida S, Sheng ZH (februar 1999). "Snapin: a SNARE-associated protein implicated in synaptic transmission". Nature Neuroscience. 2 (2): 119–24. doi:10.1038/5673. PMID 10195194. S2CID 25524692.
  26. ^ Li Y, Chin LS, Weigel C, Li L (novembar 2001). "Spring, a novel RING finger protein that regulates synaptic vesicle exocytosis". The Journal of Biological Chemistry. 276 (44): 40824–33. doi:10.1074/jbc.M106141200. PMID 11524423.
  27. ^ a b Ravichandran V, Chawla A, Roche PA (juni 1996). "Identification of a novel syntaxin- and synaptobrevin/VAMP-binding protein, SNAP-23, expressed in non-neuronal tissues". The Journal of Biological Chemistry. 271 (23): 13300–3. doi:10.1074/jbc.271.23.13300. PMID 8663154.
  28. ^ Chapman ER, An S, Barton N, Jahn R (novembar 1994). "SNAP-25, a t-SNARE which binds to both syntaxin and synaptobrevin via domains that may form coiled coils". The Journal of Biological Chemistry. 269 (44): 27427–32. doi:10.1016/S0021-9258(18)47003-2. PMID 7961655.
  29. ^ a b Steegmaier M, Yang B, Yoo JS, Huang B, Shen M, Yu S, Luo Y, Scheller RH (decembar 1998). "Three novel proteins of the syntaxin/SNAP-25 family". The Journal of Biological Chemistry. 273 (51): 34171–9. doi:10.1074/jbc.273.51.34171. PMID 9852078.
  30. ^ Imai A, Nashida T, Yoshie S, Shimomura H (august 2003). "Intracellular localisation of SNARE proteins in rat parotid acinar cells: SNARE complexes on the apical plasma membrane". Archives of Oral Biology. 48 (8): 597–604. doi:10.1016/S0003-9969(03)00116-X. PMID 12828989.
  31. ^ Li G, Alexander EA, Schwartz JH (maj 2003). "Syntaxin isoform specificity in the regulation of renal H+-ATPase exocytosis". The Journal of Biological Chemistry. 278 (22): 19791–7. doi:10.1074/jbc.M212250200. PMID 12651853.
  32. ^ Araki S, Tamori Y, Kawanishi M, Shinoda H, Masugi J, Mori H, Niki T, Okazawa H, Kubota T, Kasuga M (maj 1997). "Inhibition of the binding of SNAP-23 to syntaxin 4 by Munc18c". Biochemical and Biophysical Research Communications. 234 (1): 257–62. doi:10.1006/bbrc.1997.6560. PMID 9168999.
  33. ^ Bhaskar K, Shareef MM, Sharma VM, Shetty AP, Ramamohan Y, Pant HC, Raju TR, Shetty KT (januar 2004). "Co-purification and localization of Munc18-1 (p67) and Cdk5 with neuronal cytoskeletal proteins". Neurochemistry International. 44 (1): 35–44. doi:10.1016/S0197-0186(03)00099-8. PMID 12963086. S2CID 23783141.
  34. ^ a b Pérez-Brangulí F, Muhaisen A, Blasi J (juni 2002). "Munc 18a binding to syntaxin 1A and 1B isoforms defines its localization at the plasma membrane and blocks SNARE assembly in a three-hybrid system assay". Molecular and Cellular Neurosciences. 20 (2): 169–80. doi:10.1006/mcne.2002.1122. PMID 12093152. S2CID 23927545.
  35. ^ Widberg CH, Bryant NJ, Girotti M, Rea S, James DE (septembar 2003). "Tomosyn interacts with the t-SNAREs syntaxin4 and SNAP23 and plays a role in insulin-stimulated GLUT4 translocation". The Journal of Biological Chemistry. 278 (37): 35093–101. doi:10.1074/jbc.M304261200. PMID 12832401.
  36. ^ Fujita Y, Shirataki H, Sakisaka T, Asakura T, Ohya T, Kotani H, Yokoyama S, Nishioka H, Matsuura Y, Mizoguchi A, Scheller RH, Takai Y (maj 1998). "Tomosyn: a syntaxin-1-binding protein that forms a novel complex in the neurotransmitter release process". Neuron. 20 (5): 905–15. doi:10.1016/S0896-6273(00)80472-9. PMID 9620695. S2CID 12597505.
  37. ^ Shao X, Li C, Fernandez I, Zhang X, Südhof TC, Rizo J (januar 1997). "Synaptotagmin-syntaxin interaction: the C2 domain as a Ca2+-dependent electrostatic switch". Neuron. 18 (1): 133–42. doi:10.1016/S0896-6273(01)80052-0. PMID 9010211. S2CID 17947552.
  38. ^ Thomas DM, Ferguson GD, Herschman HR, Elferink LA (juli 1999). "Functional and biochemical analysis of the C2 domains of synaptotagmin IV". Molecular Biology of the Cell. 10 (7): 2285–95. doi:10.1091/mbc.10.7.2285. PMC 25443. PMID 10397765.
  39. ^ Betz A, Okamoto M, Benseler F, Brose N (januar 1997). "Direct interaction of the rat unc-13 homologue Munc13-1 with the N terminus of syntaxin". The Journal of Biological Chemistry. 272 (4): 2520–6. doi:10.1074/jbc.272.4.2520. PMID 8999968.
  40. ^ Margittai M, Otto H, Jahn R (mart 1999). "A stable interaction between syntaxin 1a and synaptobrevin 2 mediated by their transmembrane domains". FEBS Letters. 446 (1): 40–4. doi:10.1016/S0014-5793(99)00028-9. PMID 10100611. S2CID 9115709.
  41. ^ Hao JC, Salem N, Peng XR, Kelly RB, Bennett MK (mart 1997). "Effect of mutations in vesicle-associated membrane protein (VAMP) on the assembly of multimeric protein complexes". The Journal of Neuroscience. 17 (5): 1596–603. doi:10.1523/JNEUROSCI.17-05-01596.1997. PMC 6573372. PMID 9030619.
  42. ^ Nagamatsu S, Nakamichi Y, Watanabe T, Matsushima S, Yamaguchi S, Ni J, Itagaki E, Ishida H (januar 2001). "Localization of cellubrevin-related peptide, endobrevin, in the early endosome in pancreatic beta cells and its physiological function in exo-endocytosis of secretory granules". Journal of Cell Science. 114 (Pt 1): 219–227. doi:10.1242/jcs.114.1.219. PMID 11112705.

Dopunska literatura uredi

Vanjski linkovi uredi

Šablon:Proteini vezikulskog transporta Ovaj članak uključuje tekst iz Nacionalne medicinske biblioteke Sjedinjenih Država, koji je u javnom vlasništvu.